Comparing 209295 MicrobesOnline__882:209295 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
5yumA Crystallographic structures of ilvn.Val/ile complexes:conformational selectivity for feedback inhibition of ahass (see paper)
61% identity, 77% coverage: 12:93/107 of query aligns to 4:86/91 of 5yumA
5yppE Crystal structure of ilvn.Val-1a (see paper)
61% identity, 77% coverage: 12:93/107 of query aligns to 4:86/91 of 5yppE
Q9FFF4 Acetolactate synthase small subunit 2, chloroplastic; ALS-interacting protein 3; Acetohydroxy-acid synthase small subunit 2; Protein valine-tolerant 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 65% coverage: 14:83/107 of query aligns to 310:386/477 of Q9FFF4
Sites not aligning to the query:
6vz8G Arabidopsis thaliana acetohydroxyacid synthase complex with valine bound (see paper)
39% identity, 65% coverage: 14:83/107 of query aligns to 6:82/159 of 6vz8G
P9WKJ3 Putative acetolactate synthase small subunit; Acetohydroxy-acid synthase small subunit; AHAS; ALS; EC 2.2.1.6 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 87% coverage: 14:106/107 of query aligns to 8:101/168 of P9WKJ3
Q93YZ7 Acetolactate synthase small subunit 1, chloroplastic; ALS-interacting protein 1; Acetohydroxyacid synthase small subunit 1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
39% identity, 65% coverage: 14:83/107 of query aligns to 322:398/491 of Q93YZ7
Sites not aligning to the query:
A0QUX7 Acetolactate synthase small subunit; Acetohydroxy-acid synthase small subunit; AHAS; ALS; EC 2.2.1.6 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
32% identity, 71% coverage: 13:88/107 of query aligns to 9:86/170 of A0QUX7
2pc6A Crystal structure of putative acetolactate synthase- small subunit from nitrosomonas europaea (see paper)
31% identity, 68% coverage: 14:86/107 of query aligns to 6:80/164 of 2pc6A
O60086 Probable acetolactate synthase small subunit; Acetohydroxy-acid synthase small subunit; AHAS; ALS from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
34% identity, 62% coverage: 18:83/107 of query aligns to 77:144/289 of O60086
Sites not aligning to the query:
>209295 MicrobesOnline__882:209295
MNGAAPAAGGLIALRLTVNNHPGVMTHICGLFARRAFNVEGILCMPVGEGTSRIWLLVNE
DERLEQMIRQVRKLQDVLEVLPFPADMSAFTRLEDSMKVWESGGCRL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory