SitesBLAST
Comparing 209312 MicrobesOnline__882:209312 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2q7vA Crystal structure of deinococcus radiodurans thioredoxin reductase (see paper)
38% identity, 97% coverage: 2:298/305 of query aligns to 5:308/313 of 2q7vA
- active site: P41 (≠ C38), I45 (≠ V42), E50 (≠ V47), C141 (= C130), C144 (= C133), D145 (= D134)
- binding flavin-adenine dinucleotide: G16 (= G13), P17 (≠ V14), A18 (= A15), E37 (≠ D34), K38 (≠ E35), G43 (= G40), Q44 (≠ L41), I45 (≠ V42), N53 (= N50), E85 (vs. gap), V86 (vs. gap), T118 (= T111), G119 (= G112), C144 (= C133), G282 (= G272), D283 (= D273), Q291 (= Q281), L292 (= L282), S295 (≠ A285)
5mh4A Crystal structure of lactococcus lactis thioredoxin reductase (fr conformation) (see paper)
36% identity, 97% coverage: 5:300/305 of query aligns to 2:300/303 of 5mh4A
- active site: V34 (≠ A37), P35 (≠ C38), M39 (≠ V42), E44 (≠ V47), C130 (= C130), C133 (= C133), D134 (= D134)
- binding flavin-adenine dinucleotide: G10 (= G13), P11 (≠ V14), A12 (= A15), E31 (≠ D34), R32 (≠ E35), G37 (= G40), Q38 (≠ L41), T42 (= T45), N47 (= N50), G77 (vs. gap), V79 (≠ I83), T107 (= T111), G108 (= G112), E155 (= E155), V239 (≠ G239), F242 (≠ V242), G272 (= G272), D273 (= D273), Q281 (= Q281), I282 (≠ L282)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I146 (≠ V146), G147 (= G147), G148 (= G148), G149 (= G149), D150 (≠ N150), S151 (= S151), E154 (≠ D154), H170 (≠ E171), R171 (= R172), R172 (≠ M173), R176 (≠ F177), V234 (≠ M234), G235 (= G235), R280 (= R280), Q281 (= Q281)
5uwyA The crystal structure of thioredoxin reductase from streptococcus pyogenes mgas5005
37% identity, 98% coverage: 5:302/305 of query aligns to 5:305/306 of 5uwyA
- binding flavin-adenine dinucleotide: G13 (= G13), P14 (≠ V14), A15 (= A15), E34 (≠ D34), Q35 (≠ E35), G40 (= G40), Q41 (≠ L41), T45 (= T45), N50 (= N50), V82 (≠ I83), T110 (= T111), G111 (= G112), Y114 (vs. gap), C136 (= C133), V242 (≠ G239), G275 (= G272), D276 (= D273), Q284 (= Q281), I285 (≠ L282)
4gcmB Crystal structure of a thioredoxine reductase (trxb) from staphylococcus aureus subsp. Aureus mu50 at 1.80 a resolution
38% identity, 97% coverage: 5:300/305 of query aligns to 5:303/309 of 4gcmB
- active site: C133 (= C130), C136 (= C133), D137 (= D134)
- binding flavin-adenine dinucleotide: G11 (= G11), G13 (= G13), P14 (≠ V14), A15 (= A15), E34 (≠ D34), R35 (≠ E35), G40 (= G40), Q41 (≠ L41), T45 (= T45), N50 (= N50), D81 (≠ C82), I82 (= I83), T110 (= T111), G111 (= G112), C136 (= C133), G275 (= G272), D276 (= D273), Q284 (= Q281), I285 (≠ L282)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I117 (≠ L118), G151 (= G148), G152 (= G149), D153 (≠ N150), S154 (= S151), E157 (≠ D154), R174 (= R172), R175 (≠ M173), R179 (≠ F177), Q181 (≠ A179), I237 (≠ M234)
7jypA Structure of thioredoxin reductase from the thermophilic eubacterium thermosipho africanus tcf52b
36% identity, 96% coverage: 5:298/305 of query aligns to 6:302/305 of 7jypA
- binding flavin-adenine dinucleotide: G12 (= G11), G14 (= G13), P15 (≠ V14), A16 (= A15), F34 (≠ L33), E35 (≠ D34), K36 (≠ E35), G41 (= G40), A42 (≠ L41), V83 (≠ C82), T112 (= T111), G113 (= G112), G276 (= G272), D277 (= D273)
- binding nicotinamide-adenine-dinucleotide: G153 (= G148), G154 (= G149), S156 (= S151), Q175 (≠ E171), N176 (≠ R172), T181 (≠ F177), V238 (≠ M234)
8ccmA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with compound 2-06
38% identity, 97% coverage: 6:300/305 of query aligns to 4:302/305 of 8ccmA
- binding flavin-adenine dinucleotide: I8 (≠ L10), G9 (= G11), S10 (≠ G12), G11 (= G13), P12 (≠ V14), A13 (= A15), E32 (≠ D34), G33 (≠ E35), Q35 (≠ A37), G38 (= G40), A39 (≠ L41), L40 (≠ V42), T43 (= T45), N48 (= N50), D80 (≠ C82), V81 (≠ I83), M109 (≠ T111), G110 (= G112), T131 (≠ F129), C135 (= C133), G274 (= G272), D275 (= D273), R282 (= R280), Q283 (= Q281), A284 (≠ L282), A287 (= A285)
- binding ~{N}6-(4-aminophenyl)-1,2-benzothiazole-3,6-diamine: R114 (vs. gap), H115 (vs. gap), L116 (vs. gap), R173 (= R172), E200 (= E199), I201 (≠ V200), I235 (≠ M234)
8cclA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry a09
38% identity, 97% coverage: 6:300/305 of query aligns to 4:302/305 of 8cclA
- binding flavin-adenine dinucleotide: I8 (≠ L10), G9 (= G11), S10 (≠ G12), G11 (= G13), P12 (≠ V14), A13 (= A15), E32 (≠ D34), G33 (≠ E35), Q35 (≠ A37), G38 (= G40), A39 (≠ L41), L40 (≠ V42), T43 (= T45), N48 (= N50), D80 (≠ C82), V81 (≠ I83), M109 (≠ T111), G110 (= G112), T131 (≠ F129), C135 (= C133), G274 (= G272), D275 (= D273), R282 (= R280), Q283 (= Q281), A284 (≠ L282), A287 (= A285)
- binding [1,2]thiazolo[5,4-b]pyridin-3-amine: L116 (vs. gap), R173 (= R172), E200 (= E199), I201 (≠ V200)
8cckA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry h07
38% identity, 97% coverage: 6:300/305 of query aligns to 4:302/305 of 8cckA
- binding flavin-adenine dinucleotide: G9 (= G11), S10 (≠ G12), G11 (= G13), P12 (≠ V14), A13 (= A15), E32 (≠ D34), G33 (≠ E35), Q35 (≠ A37), G38 (= G40), A39 (≠ L41), L40 (≠ V42), T43 (= T45), N48 (= N50), D80 (≠ C82), V81 (≠ I83), M109 (≠ T111), G110 (= G112), T131 (≠ F129), C135 (= C133), G274 (= G272), D275 (= D273), R282 (= R280), Q283 (= Q281), A284 (≠ L282), A287 (= A285)
- binding ~{N}-(4-hydroxyphenyl)-2-pyrazol-1-yl-ethanamide: R114 (vs. gap), H115 (vs. gap), L116 (vs. gap), V148 (= V146), R173 (= R172), E200 (= E199), I201 (≠ V200)
8ccjA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with NADPH
38% identity, 97% coverage: 6:300/305 of query aligns to 4:302/305 of 8ccjA
- binding flavin-adenine dinucleotide: I8 (≠ L10), G9 (= G11), S10 (≠ G12), G11 (= G13), P12 (≠ V14), A13 (= A15), E32 (≠ D34), G33 (≠ E35), Q35 (≠ A37), G38 (= G40), A39 (≠ L41), L40 (≠ V42), T43 (= T45), N48 (= N50), D80 (≠ C82), V81 (≠ I83), M109 (≠ T111), G110 (= G112), T131 (≠ F129), C135 (= C133), G274 (= G272), D275 (= D273), R282 (= R280), Q283 (= Q281), A284 (≠ L282), A287 (= A285)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G148), G151 (= G149), D152 (≠ N150), S153 (= S151), E156 (≠ D154), H172 (≠ E171), R173 (= R172), R174 (≠ M173), R178 (≠ F177), I235 (≠ M234)
5uthA Crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad
38% identity, 97% coverage: 6:300/305 of query aligns to 5:303/306 of 5uthA
- active site: C133 (= C130), C136 (= C133), D137 (= D134)
- binding flavin-adenine dinucleotide: I9 (≠ L10), G10 (= G11), S11 (≠ G12), G12 (= G13), P13 (≠ V14), A14 (= A15), F32 (≠ L33), E33 (≠ D34), G34 (≠ E35), Q36 (≠ A37), G39 (= G40), A40 (≠ L41), L41 (≠ V42), N49 (= N50), D81 (≠ C82), V82 (≠ I83), M110 (≠ T111), G111 (= G112), C136 (= C133), G275 (= G272), D276 (= D273), R283 (= R280), Q284 (= Q281), A285 (≠ L282), A288 (= A285)
7aawA Thioredoxin reductase from bacillus cereus (see paper)
35% identity, 97% coverage: 5:301/305 of query aligns to 7:306/315 of 7aawA
- binding flavin-adenine dinucleotide: G13 (= G11), G15 (= G13), P16 (≠ V14), A17 (= A15), E36 (≠ D34), R37 (≠ E35), G42 (= G40), Q43 (≠ L41), T47 (= T45), N52 (= N50), G82 (≠ A80), V84 (≠ C82), A111 (= A110), S112 (≠ T111), G113 (= G112), C138 (= C133), G277 (= G272), D278 (= D273), Q286 (= Q281), I287 (≠ L282)
- binding alpha-D-glucopyranose: R27 (= R25), D49 (≠ V47), K74 (≠ N72), F75 (≠ L73), P122 (≠ A121), G123 (= G122), E126 (= E125), G129 (vs. gap), G131 (≠ Q126), V132 (= V127), F143 (≠ Y138), E206 (≠ S202), N208 (≠ D204)
7aawB Thioredoxin reductase from bacillus cereus (see paper)
35% identity, 97% coverage: 5:301/305 of query aligns to 4:303/311 of 7aawB
- binding flavin-adenine dinucleotide: G10 (= G11), G12 (= G13), P13 (≠ V14), A14 (= A15), E33 (≠ D34), R34 (≠ E35), G39 (= G40), Q40 (≠ L41), T44 (= T45), N49 (= N50), G79 (≠ A80), D80 (≠ V81), V81 (≠ C82), S109 (≠ T111), G110 (= G112), Y113 (≠ P115), C135 (= C133), G274 (= G272), D275 (= D273), Q283 (= Q281), I284 (≠ L282)
- binding alpha-D-glucopyranose: D46 (≠ V47), E48 (= E49), G126 (vs. gap), G128 (≠ Q126), D136 (= D134), A138 (= A136), F139 (≠ P137), F139 (≠ P137), F140 (≠ Y138)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G148), G151 (= G149), D152 (≠ N150), S153 (= S151), E156 (≠ D154), H172 (≠ E171), R173 (= R172), R174 (≠ M173), R178 (≠ F177), I236 (≠ M234)
P9WHH1 Thioredoxin reductase; TR; TRXR; EC 1.8.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
37% identity, 98% coverage: 6:303/305 of query aligns to 16:320/335 of P9WHH1
- SGPA 22:25 (≠ GGVA 12:15) binding
- Y32 (= Y22) modified: Phosphotyrosine; by PtkA; mutation to A: Significantly reduces phosphorylation.
- 44:51 (vs. 34:41, 25% identical) binding
- N60 (= N50) binding
- V93 (≠ I83) binding
- C145 (= C130) modified: Disulfide link with 148, Redox-active
- C148 (= C133) modified: Disulfide link with 145, Redox-active
- S166 (= S151) binding
- H185 (≠ E171) binding
- R191 (≠ F177) binding
- I248 (≠ M234) binding
- Y268 (= Y254) binding
- D288 (= D273) binding
- R295 (= R280) binding
- RQAV 295:298 (≠ RQLT 280:283) binding
2a87A Crystal structure of m. Tuberculosis thioredoxin reductase (see paper)
37% identity, 98% coverage: 6:303/305 of query aligns to 7:311/313 of 2a87A
- active site: F39 (≠ C38), L43 (≠ V42), D48 (≠ V47), C136 (= C130), C139 (= C133), D140 (= D134)
- binding flavin-adenine dinucleotide: G12 (= G11), S13 (≠ G12), G14 (= G13), P15 (≠ V14), A16 (= A15), F34 (≠ L33), E35 (≠ D34), G36 (≠ E35), G40 (= G39), G41 (= G40), A42 (≠ L41), L43 (≠ V42), T46 (= T45), V49 (= V48), N51 (= N50), D83 (≠ C82), V84 (≠ I83), M113 (≠ T111), C139 (= C133), G278 (= G272), D279 (= D273), R286 (= R280), Q287 (= Q281), A288 (≠ L282), V289 (≠ T283)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L120 (= L118), G155 (= G149), D156 (≠ N150), S157 (= S151), H176 (≠ E171), R177 (= R172), R178 (≠ M173), R182 (≠ F177), I239 (≠ M234), Y259 (= Y254), R283 (≠ K277), R286 (= R280)
5u63B Crystal structure of putative thioredoxin reductase from haemophilus influenzae
35% identity, 98% coverage: 1:300/305 of query aligns to 7:316/319 of 5u63B
- active site: C139 (= C130), C142 (= C133), D143 (= D134)
- binding flavin-adenine dinucleotide: G16 (= G11), S17 (≠ G12), G18 (= G13), P19 (≠ V14), A20 (= A15), T39 (≠ D34), G40 (≠ E35), Q42 (≠ A37), G45 (= G40), Q46 (≠ L41), L47 (≠ V42), T50 (= T45), N55 (= N50), H87 (≠ S85), I88 (≠ M86), A115 (= A110), T116 (= T111), G117 (= G112), H248 (≠ Q236), G288 (= G272), D289 (= D273), R296 (= R280), Q297 (= Q281), A298 (≠ L282), S301 (≠ A285)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R121 (vs. gap), G157 (= G148), H179 (≠ E171), R180 (= R172), R181 (≠ M173), I246 (≠ M234), G247 (= G235), H248 (≠ Q236), R296 (= R280)
Q70G58 Thioredoxin reductase NTRC; NADPH-dependent thioredoxin reductase C; OsNTRC; EC 1.8.1.9 from Oryza sativa subsp. japonica (Rice) (see 2 papers)
34% identity, 97% coverage: 6:300/305 of query aligns to 71:377/515 of Q70G58
- C203 (= C130) mutation to S: Loss of thioredoxin reductase activity.
- C206 (= C133) mutation to S: Loss of thioredoxin reductase activity.
- A227 (≠ G152) mutation to G: Reduces activity 30-fold; when associated with E-245 and F-246.
- V245 (≠ E171) mutation to E: Reduces activity 30-fold; when associated with G-227 and F-246.
- R246 (= R172) mutation to F: Reduces activity 30-fold; when associated with G-227 and E-245.
Sites not aligning to the query:
- 440 C→S: Loss of thioredoxin activity.
- 443 C→S: Loss of thioredoxin activity.
6bpyA Aspergillus fumigatus thioredoxin reductase (see paper)
34% identity, 97% coverage: 7:303/305 of query aligns to 5:322/324 of 6bpyA
- binding flavin-adenine dinucleotide: I8 (≠ L10), G9 (= G11), S10 (≠ G12), G11 (= G13), P12 (≠ V14), A13 (= A15), Y31 (vs. gap), E32 (vs. gap), G33 (vs. gap), A36 (≠ D34), T38 (≠ N36), A39 (= A37), G42 (= G40), Q43 (≠ L41), L44 (≠ V42), T47 (= T45), I50 (≠ V48), N52 (= N50), T84 (≠ V81), I85 (= I83), T120 (= T111), G121 (= G112), C146 (= C133), G291 (= G272), D292 (= D273), R299 (= R280), Q300 (= Q281), A301 (≠ L282), S304 (≠ A285)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G163 (= G148), G164 (= G149), S166 (= S151), R186 (= R172), R187 (≠ M173), R191 (≠ F177), V252 (≠ M234)
4jnqA Crystal structure of a thioredoxin reductase from brucella melitensis
36% identity, 96% coverage: 7:300/305 of query aligns to 9:311/315 of 4jnqA
- active site: C137 (= C130), C140 (= C133), D141 (= D134)
- binding dihydroflavine-adenine dinucleotide: I12 (≠ L10), G13 (= G11), S14 (≠ G12), G15 (= G13), P16 (≠ V14), A17 (= A15), A36 (≠ D34), G37 (≠ E35), Q39 (≠ A37), G42 (= G40), Q43 (≠ L41), L44 (≠ V42), N52 (= N50), I85 (= I83), A113 (= A110), T114 (= T111), C140 (= C133), G283 (= G272), D284 (= D273), R291 (= R280), Q292 (= Q281), A293 (≠ L282)
5vt3B High resolution structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 in complex with NADP and fad
36% identity, 99% coverage: 1:302/305 of query aligns to 6:317/319 of 5vt3B
- active site: C138 (= C130), C141 (= C133), D142 (= D134)
- binding flavin-adenine dinucleotide: G15 (= G11), S16 (≠ G12), G17 (= G13), P18 (≠ V14), A19 (= A15), T38 (≠ D34), G39 (≠ E35), Q41 (≠ A37), G44 (= G40), Q45 (≠ L41), L46 (≠ V42), T49 (= T45), N54 (= N50), H86 (≠ S85), I87 (≠ M86), S114 (≠ A110), T115 (= T111), G116 (= G112), E162 (≠ D154), H247 (≠ Q236), G287 (= G272), D288 (= D273), R295 (= R280), Q296 (= Q281), A297 (≠ L282), S300 (≠ A285)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L122 (= L118), G156 (= G148), G157 (= G149), N158 (= N150), T159 (≠ S151), H178 (≠ E171), R179 (= R172), R180 (≠ M173), R184 (≠ K181), I245 (≠ M234), G246 (= G235), R295 (= R280), Q296 (= Q281)
7p9eB Chlamydomonas reinhardtii NADPH dependent thioredoxin reductase 1 domain cs mutant (see paper)
34% identity, 97% coverage: 6:300/305 of query aligns to 3:304/316 of 7p9eB
- binding flavin-adenine dinucleotide: G8 (= G11), S9 (≠ G12), G10 (= G13), P11 (≠ V14), A12 (= A15), E31 (≠ D34), G32 (vs. gap), N35 (= N36), G36 (≠ A37), G39 (= G40), Q40 (≠ L41), L41 (≠ V42), T44 (= T45), N49 (= N50), D81 (≠ E79), V82 (≠ I83), A109 (= A110), T110 (= T111), W126 (≠ E123), S136 (≠ C133), G276 (= G272), D277 (= D273), R284 (= R280), Q285 (= Q281), A286 (≠ L282), A289 (= A285)
Query Sequence
>209312 MicrobesOnline__882:209312
MSHAFDLIILGGGVAGMTSAIYAARANLRVLILDENACGGLVNWTKVVENMPSYTSIGGM
ELAQRMQEQVNNLGVTVEEAVCIDSMDLTGPEKRVEADGEVYTAKAVIVATGRKPVPLEA
AGECEQVHFCAICDGAPYIGKRVLVVGGGNSGFDESLALLDQGIAELTLVERMDRFFAAQ
KAQDLLAARPNATLMRSTEVVSVDYDETLRSVTLRDVATGEVFTREFDGIFVFMGQKPGT
EVFRGQFDMDAQGYIVTDENMATSLSGVYAAGDVRQKKYRQLTTAMADGTMAALEAERFI
HSAPA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory