Comparing 209322 MicrobesOnline__882:209322 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
39% identity, 87% coverage: 31:246/249 of query aligns to 9:225/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
38% identity, 87% coverage: 31:246/249 of query aligns to 9:223/225 of 4zv2A
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
35% identity, 87% coverage: 31:247/249 of query aligns to 15:229/229 of 5t0wA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
36% identity, 88% coverage: 31:248/249 of query aligns to 15:229/229 of 6svfA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
31% identity, 92% coverage: 22:249/249 of query aligns to 1:227/235 of 2pvuA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
30% identity, 92% coverage: 21:249/249 of query aligns to 6:233/241 of 2q2aA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
31% identity, 90% coverage: 26:249/249 of query aligns to 1:223/231 of 2q2cA
4ohnA Crystal structure of an abc uptake transporter substrate binding protein from streptococcus pneumoniae with bound histidine
34% identity, 87% coverage: 31:246/249 of query aligns to 18:239/246 of 4ohnA
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
30% identity, 99% coverage: 1:246/249 of query aligns to 1:253/260 of P02911
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
31% identity, 87% coverage: 31:246/249 of query aligns to 9:231/238 of 1hslA
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
31% identity, 87% coverage: 31:246/249 of query aligns to 31:253/260 of P02910
Sites not aligning to the query:
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
31% identity, 87% coverage: 31:246/249 of query aligns to 31:253/260 of P0AEU0
Sites not aligning to the query:
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
31% identity, 87% coverage: 31:246/249 of query aligns to 6:228/235 of 5owfA
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
31% identity, 87% coverage: 31:246/249 of query aligns to 9:231/238 of 1lstA
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
31% identity, 87% coverage: 31:246/249 of query aligns to 9:231/238 of 1lahE
1lagE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
31% identity, 87% coverage: 31:246/249 of query aligns to 9:231/238 of 1lagE
1lafE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
31% identity, 87% coverage: 31:246/249 of query aligns to 9:231/238 of 1lafE
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
32% identity, 90% coverage: 24:246/249 of query aligns to 12:234/235 of 4g4pA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
34% identity, 88% coverage: 29:248/249 of query aligns to 4:224/224 of 4ymxA
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
30% identity, 91% coverage: 21:246/249 of query aligns to 1:227/228 of 2y7iA
>209322 MicrobesOnline__882:209322
MKRSFVYTVVMALVLAFASVAAAEEKTYINGIDANYPPFAYVDKDGKPAGFDVDSMNWIA
AKMGFKVVHKPMDWDGIVPSLLAKKIDMVCSGMSITDARKKQITFSEPYWTVSQVFVAKK
DSKLSVDDVYKGKKKLGVQRGTSEADALQKQAPEKGWNFELRFYDSAPLAIEDVLNGRID
AAGMDILPAEDAAAKKPVKILGTFGEPEDFGVATRNEDTELRGKINEGYKLLMADPYWQQ
LKDKYLQKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory