SitesBLAST
Comparing 209326 MicrobesOnline__882:209326 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
33% identity, 98% coverage: 7:458/460 of query aligns to 16:463/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P72), G75 (= G74), S76 (≠ G75), G77 (= G76), T78 (= T77), G79 (= G78), L80 (= L79), A83 (≠ G82), C84 (= C83), P137 (= P136), G138 (= G138), E139 (≠ M139), A142 (≠ S142), T143 (= T143), G146 (= G146), N147 (= N147), S149 (≠ A149), T150 (= T150), A152 (= A152), G153 (= G153), E203 (= E203), G204 (= G204), I209 (= I209), E422 (= E417), H423 (= H418)
- binding fe (iii) ion: H377 (= H375), H384 (= H382), E422 (= E417)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
34% identity, 91% coverage: 41:458/460 of query aligns to 38:464/465 of 3pm9A
- active site: A149 (= A152), L159 (≠ V162)
- binding flavin-adenine dinucleotide: P69 (= P72), Q70 (≠ R73), G71 (= G74), G72 (= G75), N73 (≠ G76), T74 (= T77), G75 (= G78), L76 (= L79), G79 (= G82), Q80 (≠ C83), L91 (≠ V94), L133 (≠ P136), G134 (≠ A137), A135 (≠ G138), C139 (≠ S142), T140 (= T143), G142 (= G145), G143 (= G146), S146 (≠ A149), T147 (= T150), A149 (= A152), G150 (= G153), E200 (= E203), G201 (= G204), I205 (≠ V208), I206 (= I209), E423 (= E417)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 89% coverage: 50:459/460 of query aligns to 49:456/459 of P9WIT1
- K354 (≠ D354) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
34% identity, 90% coverage: 44:459/460 of query aligns to 40:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (= G76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ C83), L90 (≠ V94), P132 (= P136), G133 (= G138), A134 (≠ M139), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), W322 (≠ S330), E413 (= E417), H414 (= H418), N450 (= N454)
- binding lactic acid: R318 (= R326), H369 (= H375), H376 (= H382), H414 (= H418)
- binding manganese (ii) ion: H369 (= H375), H376 (= H382), E413 (= E417)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
34% identity, 90% coverage: 44:459/460 of query aligns to 40:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R326), H369 (= H375), H376 (= H382), H414 (= H418)
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (= G76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ C83), L90 (≠ V94), P132 (= P136), G133 (= G138), A134 (≠ M139), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), W322 (≠ S330), E413 (= E417), H414 (= H418), N450 (= N454)
- binding manganese (ii) ion: H369 (= H375), H376 (= H382), E413 (= E417)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
34% identity, 90% coverage: 44:459/460 of query aligns to 40:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (= G76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ C83), L90 (≠ V94), P132 (= P136), G133 (= G138), A134 (≠ M139), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), W323 (≠ S330), E414 (= E417), H415 (= H418), N451 (= N454)
- binding manganese (ii) ion: H370 (= H375), H377 (= H382), E414 (= E417)
- binding pyruvic acid: R319 (= R326), H370 (= H375), H377 (= H382), H415 (= H418)
Sites not aligning to the query:
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
34% identity, 90% coverage: 44:459/460 of query aligns to 40:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L79), R317 (= R326), W321 (≠ S330), H368 (= H375), H375 (= H382), H413 (= H418)
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (= G76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ C83), L90 (≠ V94), P132 (= P136), G133 (= G138), A134 (≠ M139), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), W321 (≠ S330), Y322 (= Y336), E412 (= E417), H413 (= H418), N449 (= N454)
- binding manganese (ii) ion: H368 (= H375), H375 (= H382), E412 (= E417)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
34% identity, 90% coverage: 44:459/460 of query aligns to 40:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (= G76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ C83), L90 (≠ V94), P132 (= P136), G133 (= G138), A134 (≠ M139), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), W322 (≠ S330), E413 (= E417), H414 (= H418), N450 (= N454)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R326), H369 (= H375), H376 (= H382), H414 (= H418)
- binding manganese (ii) ion: H369 (= H375), H376 (= H382), E413 (= E417)
Sites not aligning to the query:
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
33% identity, 95% coverage: 23:459/460 of query aligns to 7:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R326), W322 (≠ S330), H369 (= H375), H376 (= H382), H414 (= H418)
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (= G76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ C83), L90 (≠ V94), P132 (= P136), G133 (= G138), A134 (≠ M139), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), W322 (≠ S330), E413 (= E417), N450 (= N454)
- binding manganese (ii) ion: H369 (= H375), H376 (= H382), E413 (= E417)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
33% identity, 95% coverage: 23:459/460 of query aligns to 7:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R326), W322 (≠ S330), H369 (= H375), H376 (= H382), H413 (= H418)
- binding flavin-adenine dinucleotide: E32 (vs. gap), P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (= G76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ C83), L90 (≠ V94), P132 (= P136), G133 (= G138), A134 (≠ M139), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), W322 (≠ S330), E412 (= E417), H413 (= H418), N449 (= N454)
- binding manganese (ii) ion: H369 (= H375), H376 (= H382), E412 (= E417)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
33% identity, 95% coverage: 23:459/460 of query aligns to 7:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R326), W322 (≠ S330), S336 (= S342), H369 (= H375), H376 (= H382), H413 (= H418)
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (= G76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ C83), L90 (≠ V94), P132 (= P136), G133 (= G138), A134 (≠ M139), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), E412 (= E417), N449 (= N454)
- binding manganese (ii) ion: H369 (= H375), H376 (= H382), E412 (= E417)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
34% identity, 90% coverage: 44:459/460 of query aligns to 40:455/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (= G76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ C83), L90 (≠ V94), P132 (= P136), G133 (= G138), A134 (≠ M139), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), H369 (= H375), E413 (= E417), N450 (= N454)
- binding deaminohydroxyvaline: R319 (= R326), H414 (= H418)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
34% identity, 90% coverage: 44:459/460 of query aligns to 40:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (= G76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ C83), L90 (≠ V94), P132 (= P136), G133 (= G138), A134 (≠ M139), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), Y324 (= Y336), H370 (= H375), E414 (= E417), N451 (= N454)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R326), W323 (≠ S330), H415 (= H418)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
34% identity, 90% coverage: 44:459/460 of query aligns to 40:456/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R326), W323 (≠ S330), H370 (= H375), H415 (= H418)
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (= G76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ C83), L90 (≠ V94), P132 (= P136), G133 (= G138), A134 (≠ M139), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), H370 (= H375), E414 (= E417), N451 (= N454)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
34% identity, 90% coverage: 44:459/460 of query aligns to 40:456/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R326), W323 (≠ S330), H415 (= H418)
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (= G76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ C83), L90 (≠ V94), P132 (= P136), G133 (= G138), A134 (≠ M139), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), Y324 (= Y336), H370 (= H375), E414 (= E417), N451 (= N454)
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
34% identity, 90% coverage: 44:459/460 of query aligns to 40:456/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (= G76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ C83), L90 (≠ V94), P132 (= P136), G133 (= G138), A134 (≠ M139), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), H370 (= H375), E414 (= E417), N451 (= N454)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R326), W323 (≠ S330), H415 (= H418)
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
34% identity, 90% coverage: 44:459/460 of query aligns to 40:456/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (= G76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ C83), L90 (≠ V94), P132 (= P136), G133 (= G138), A134 (≠ M139), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), H370 (= H375), E414 (= E417), N451 (= N454)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R326), H415 (= H418)
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
34% identity, 90% coverage: 44:459/460 of query aligns to 40:456/456 of 8jdbA
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (= G76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ C83), L90 (≠ V94), P132 (= P136), G133 (= G138), A134 (≠ M139), G140 (= G146), M141 (≠ N147), A143 (= A149), T144 (= T150), A146 (= A152), S147 (≠ G153), E200 (= E203), G201 (= G204), I206 (= I209), Y324 (= Y336), H370 (= H375), E414 (= E417), N451 (= N454)
- binding (2R)-2-oxidanyloctanoic acid: V75 (≠ L79), R319 (= R326), W323 (≠ S330), H415 (= H418)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
31% identity, 92% coverage: 40:460/460 of query aligns to 43:465/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R326), T337 (≠ S330), K348 (≠ S342), Y379 (≠ F373), H381 (= H375), H388 (= H382), H423 (= H418)
- binding flavin-adenine dinucleotide: P75 (= P72), Q76 (≠ R73), G77 (= G74), G78 (= G75), N79 (≠ G76), T80 (= T77), G81 (= G78), M82 (≠ L79), G85 (= G82), S86 (≠ C83), L139 (≠ P136), G140 (≠ A137), A141 (≠ G138), C145 (≠ S142), G149 (= G146), N150 (= N147), A152 (= A149), T153 (= T150), G157 (= G154), G207 (= G204), I212 (= I209), E422 (= E417), N459 (= N454)
- binding zinc ion: H381 (= H375), H388 (= H382), E422 (= E417)
Sites not aligning to the query:
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
31% identity, 92% coverage: 40:460/460 of query aligns to 43:465/466 of 6lpuA
- binding flavin-adenine dinucleotide: P75 (= P72), G77 (= G74), G78 (= G75), N79 (≠ G76), T80 (= T77), G81 (= G78), G85 (= G82), S86 (≠ C83), L139 (≠ P136), G140 (≠ A137), A141 (≠ G138), C145 (≠ S142), H146 (≠ T143), G148 (= G145), G149 (= G146), N150 (= N147), A152 (= A149), T153 (= T150), A155 (= A152), E206 (= E203), G207 (= G204), I211 (≠ V208), I212 (= I209), E422 (= E417), N459 (= N454)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R326), T337 (≠ S330), K348 (≠ S342), Y379 (≠ F373), H381 (= H375), H388 (= H382), H423 (= H418)
- binding zinc ion: H381 (= H375), H388 (= H382), E422 (= E417)
Sites not aligning to the query:
Query Sequence
>209326 MicrobesOnline__882:209326
MTVSTTRLTPALRTAIIDAVGRDAVLDTAGAPYDRDASELRATPDMVVLPESVGQIQALM
RLATEHRFPVIPRGGGTGLAGGCLALMGGVVLSVERMNRVRAIDTRNLVAEVDAGCITQT
LRDAAAAANLFYPPDPAGMDRSTVGGNVATNAGGPACVKYGVTRDYVLGVEAVLPDGELL
RAGVRTRKGVVGYDMAHLLCGSEGTLGVITGLTMKLIPLPAATVGMAVAFADMPSAMRAV
AAVLGAGHLPSAIEFMDHRCLALVGEMLPFPVPGARPSLLIIELDGQRATIEPQLDAVAA
ICREQGATQVLPAPTDAERATIWGVRRQVSLRIHDYAGLYLSEDVAVPLVAIADLVAELP
AFEERYGLEIFAFGHAGDGNIHLNVTSSSTDNRERAEEGVVALARRVVELGGTISGEHGI
GEAKKHLVPLELSARSIALQKGIRGVFDPLGIMNPGKVFP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory