Comparing 209400 MicrobesOnline__882:209400 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
2pv7B Crystal structure of chorismate mutase / prephenate dehydrogenase (tyra) (1574749) from haemophilus influenzae rd at 2.00 a resolution (see paper)
31% identity, 80% coverage: 2:204/255 of query aligns to 11:215/280 of 2pv7B
2f1kA Crystal structure of synechocystis arogenate dehydrogenase (see paper)
27% identity, 68% coverage: 4:177/255 of query aligns to 14:197/279 of 2f1kA
Sites not aligning to the query:
5t9fB Prephenate dehydrogenase n222d mutant from soybean (see paper)
26% identity, 71% coverage: 47:226/255 of query aligns to 60:242/253 of 5t9fB
Sites not aligning to the query:
>209400 MicrobesOnline__882:209400
MKIALVGDKGRMGRLLTSRFSAAGCEVAGVDRPLTPDTVRPAVQGADVVILCVPVEVLAE
VLSIVAPLLSPKQVLADITSVKVRPMEVMQAFHAGPVVGTHPLFGPDPQDDHLPVAVTPG
SSARDADVTLVEQCFRMIGCDTFRTTAQEHDRAAAMIQGLNFISSVAYLATLAHNEELLP
FVTPSFRRRLDAARKMLTEDAALFEGMFEANPASQDAVRSFRSFLNIASAGDVDVLVDRA
RWWWRTHDDRGGARQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory