Comparing 209402 MicrobesOnline__882:209402 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00903 Aminodeoxychorismate synthase component 2; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 2; Aminodeoxychorismate synthase, glutamine amidotransferase component; EC 2.6.1.85 from Escherichia coli (strain K12) (see paper)
48% identity, 89% coverage: 1:185/209 of query aligns to 1:184/187 of P00903
8hx8A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate (see paper)
42% identity, 97% coverage: 3:205/209 of query aligns to 7:207/673 of 8hx8A
Sites not aligning to the query:
Q42565 Anthranilate synthase beta subunit 1, chloroplastic; Anthranilate synthase component 2-1; Anthranilate synthase, glutamine amidotransferase component 2-1; Protein TRYPTOPHAN BIOSYNTHESIS 4; Protein WEAK ETHYLENE INSENSITIVE 7; EC 4.1.3.27 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
44% identity, 88% coverage: 2:185/209 of query aligns to 75:263/276 of Q42565
P00900 Anthranilate synthase component 2; AS; ASII; Anthranilate synthase, GATase component; Anthranilate synthase, glutamine amidotransferase component; EC 4.1.3.27 from Serratia marcescens (see 3 papers)
43% identity, 87% coverage: 2:182/209 of query aligns to 4:183/193 of P00900
Sites not aligning to the query:
1i7qB Anthranilate synthase from s. Marcescens (see paper)
43% identity, 87% coverage: 2:182/209 of query aligns to 3:182/192 of 1i7qB
8hx9A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae with chorismate (see paper)
37% identity, 88% coverage: 3:185/209 of query aligns to 6:144/632 of 8hx9A
Sites not aligning to the query:
7yc6A Crystal structure of d110p mutant of gatase subunit of methanocaldococcus jannaschii gmp synthetase
28% identity, 91% coverage: 1:190/209 of query aligns to 1:179/183 of 7yc6A
2ywcA Crystal structure of gmp synthetase from thermus thermophilus in complex with xmp
30% identity, 91% coverage: 1:190/209 of query aligns to 1:185/475 of 2ywcA
Sites not aligning to the query:
3r75B Crystal structure of 2-amino-2-desoxyisochorismate synthase (adic) synthase phze from burkholderia lata 383 in complex with benzoate, pyruvate, glutamine and contaminating zn2+ (see paper)
33% identity, 87% coverage: 3:184/209 of query aligns to 434:612/622 of 3r75B
Sites not aligning to the query:
P20054 Multifunctional protein pyr1-3; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Dictyostelium discoideum (Social amoeba)
31% identity, 73% coverage: 33:185/209 of query aligns to 225:378/2225 of P20054
Sites not aligning to the query:
5tw7F Crystal structure of a gmp synthase (glutamine-hydrolyzing) from neisseria gonorrhoeae
31% identity, 59% coverage: 74:197/209 of query aligns to 75:199/490 of 5tw7F
Sites not aligning to the query:
P27708 Multifunctional protein CAD; Carbamoyl phosphate synthetase 2-aspartate transcarbamylase-dihydroorotase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Homo sapiens (Human) (see 7 papers)
26% identity, 76% coverage: 50:208/209 of query aligns to 219:375/2225 of P27708
Sites not aligning to the query:
P08955 Multifunctional protein CAD; Carbamoyl phosphate synthetase 2-aspartate transcarbamylase-dihydroorotase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Mesocricetus auratus (Golden hamster) (see paper)
27% identity, 78% coverage: 46:207/209 of query aligns to 215:374/2225 of P08955
Sites not aligning to the query:
P07258 Carbamoyl phosphate synthase arginine-specific small chain; CPS; CPSase; CPSase-arg; Arginine-specific carbamoyl phosphate synthetase, glutamine chain; Carbamoyl phosphate synthase A; CPS-A; Glutamine-dependent carbamoyl phosphate synthetase; EC 6.3.5.5 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 62% coverage: 44:172/209 of query aligns to 223:352/411 of P07258
Q18990 Multifunctional protein pyr-1; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Caenorhabditis elegans (see 3 papers)
27% identity, 68% coverage: 41:182/209 of query aligns to 214:352/2198 of Q18990
Sites not aligning to the query:
P05990 Multifunctional protein r; Protein rudimentary; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Drosophila melanogaster (Fruit fly) (see 2 papers)
24% identity, 66% coverage: 45:182/209 of query aligns to 232:366/2224 of P05990
Sites not aligning to the query:
1ce8B Carbamoyl phosphate synthetase from escherichis coli with complexed with the allosteric ligand imp (see paper)
27% identity, 67% coverage: 46:185/209 of query aligns to 233:369/379 of 1ce8B
Sites not aligning to the query:
P0A6F1 Carbamoyl phosphate synthase small chain; Carbamoyl phosphate synthetase glutamine chain; EC 6.3.5.5 from Escherichia coli (strain K12) (see paper)
27% identity, 67% coverage: 46:185/209 of query aligns to 234:370/382 of P0A6F1
Sites not aligning to the query:
Q9LVW7 Carbamoyl phosphate synthase small chain, chloroplastic; Carbamoyl phosphate synthetase glutamine chain; Protein VENOSA 6; EC 6.3.5.5 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 76% coverage: 14:172/209 of query aligns to 254:405/430 of Q9LVW7
Sites not aligning to the query:
1gpmA Escherichia coli gmp synthetase complexed with amp and pyrophosphate (see paper)
27% identity, 66% coverage: 48:185/209 of query aligns to 52:195/501 of 1gpmA
Sites not aligning to the query:
>209402 MicrobesOnline__882:209402
MFLLIDNYDSFTFNLVQAFYGLGLAPVVVRNDDPALVACATRPDLDMVCISPGPSHPRNA
GGCLAFLDVLPRTVPVLGVCLGHQVLGLYAGATVEVGPRIMHGKTSDITHDGAGLFAGLP
QPMTVGRYHSLIVRAEEKPDLLEVTARTPEGEVMAMRYRDRPWVGVQFHPESVLTPDGVR
LLGNFPAMTGGSCPRMTPHGATVRQEVTA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory