Comparing 209404 MicrobesOnline__882:209404 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1vc4B Crystal structure of indole-3-glycerol phosphate synthase (trpc) from thermus thermophilus at 1.8 a resolution (see paper)
43% identity, 92% coverage: 17:253/257 of query aligns to 14:254/254 of 1vc4B
3t44A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with indole glycerol phosphate (igp) amd anthranilate
42% identity, 83% coverage: 39:252/257 of query aligns to 42:255/259 of 3t44A
3t55A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with phenoxymethyl benzoic acid (pmba)
42% identity, 83% coverage: 39:252/257 of query aligns to 42:255/258 of 3t55A
3t78A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with 5-fluoroanthranilate
42% identity, 83% coverage: 39:252/257 of query aligns to 42:253/257 of 3t78A
6y88B Igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp (see paper)
36% identity, 95% coverage: 10:252/257 of query aligns to 23:263/265 of 6y88B
1lbfA Crystal structure of indole-3-glycerol phosphate syntase (igps)with reduced 1-(o-caboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) (see paper)
36% identity, 76% coverage: 46:241/257 of query aligns to 46:238/247 of 1lbfA
Sites not aligning to the query:
1jukA Indole-3-glycerolphosphate synthase from sulfolobus solfataricus in a trigonal crystal form (see paper)
36% identity, 76% coverage: 46:241/257 of query aligns to 46:238/247 of 1jukA
1igsA Indole-3-glycerolphosphate synthase from sulfolobus solfataricus at 2.0 a resolution (see paper)
36% identity, 76% coverage: 46:241/257 of query aligns to 46:238/247 of 1igsA
1a53A Complex of indole-3-glycerolphosphate synthase from sulfolobus solfataricus with indole-3-glycerolphosphate at 2.0 a resolution (see paper)
36% identity, 76% coverage: 46:241/257 of query aligns to 46:238/247 of 1a53A
6y88G Igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp (see paper)
36% identity, 94% coverage: 15:255/257 of query aligns to 19:253/253 of 6y88G
3t40A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) complex with n-2-carboxyphenyl glycine (cpg)
39% identity, 83% coverage: 39:252/257 of query aligns to 42:241/251 of 3t40A
4iwwA Computational design of an unnatural amino acid metalloprotein with atomic level accuracy (see paper)
34% identity, 76% coverage: 46:241/257 of query aligns to 46:238/247 of 4iwwA
3uxdA Designed protein ke59 r1 7/10h with dichlorobenzotriazole (dbt) (see paper)
34% identity, 76% coverage: 46:241/257 of query aligns to 46:238/247 of 3uxdA
1jcmP Trpc stability mutant containing an engineered disulphide bridge and in complex with a cdrp-related substrate (see paper)
33% identity, 84% coverage: 36:252/257 of query aligns to 39:253/259 of 1jcmP
Sites not aligning to the query:
1piiA Three-dimensional structure of the bifunctional enzyme phosphoribosylanthranilate isomerase: indoleglycerolphosphate synthase from escherichia coli refined at 2.0 angstroms resolution (see paper)
33% identity, 84% coverage: 36:252/257 of query aligns to 39:253/452 of 1piiA
Sites not aligning to the query:
5k7jA Structure of designed zinc binding protein ze2 bound to zn2+ (see paper)
32% identity, 76% coverage: 46:241/257 of query aligns to 46:231/240 of 5k7jA
3nz1A Crystal structure of kemp elimination catalyst 1a53-2 complexed with transition state analog 5-nitro benzotriazole (see paper)
31% identity, 81% coverage: 46:253/257 of query aligns to 46:248/249 of 3nz1A
3uzjA Designed protein ke59 r13 3/11h with benzotriazole (see paper)
31% identity, 76% coverage: 46:241/257 of query aligns to 46:238/247 of 3uzjA
3uz5A Designed protein ke59 r13 3/11h (see paper)
31% identity, 76% coverage: 46:241/257 of query aligns to 46:238/247 of 3uz5A
4ou1A Crystal structure of a computationally designed retro-aldolase covalently bound to folding probe 1 [(6-methoxynaphthalen-2-yl) (oxiran-2-yl)methanol] (see paper)
31% identity, 76% coverage: 46:241/257 of query aligns to 46:238/247 of 4ou1A
>209404 MicrobesOnline__882:209404
MLERFRAAKRHEVDKLEQCARRGGLPAPFAGPRPAFGTALRGDGLAVIAEYKRASPSCGV
IDTKLTPEEVATAYEAGGATAISVLTEEVHFRGELSYLGRMTAPGLPLLRKDFIMHPLQV
TATAATPASALLLIVRLTPDAALLRDLREQAEAQGMDAVVEVFDTDDLDIARASGARIIQ
VNARDLDTLKVSMPACLGMGVLRDAAETWVAASGMSAPEHLAAAATAGYDAALVGTALMR
GGDPGAALRALLGREAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory