Comparing 209405 MicrobesOnline__882:209405 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
1piiA Three-dimensional structure of the bifunctional enzyme phosphoribosylanthranilate isomerase: indoleglycerolphosphate synthase from escherichia coli refined at 2.0 angstroms resolution (see paper)
35% identity, 81% coverage: 39:268/284 of query aligns to 258:451/452 of 1piiA
Sites not aligning to the query:
1nsjA Crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima (see paper)
28% identity, 79% coverage: 36:260/284 of query aligns to 2:196/205 of 1nsjA
1lbmA Crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5- phosphate (rcdrp) (see paper)
26% identity, 79% coverage: 36:260/284 of query aligns to 2:185/194 of 1lbmA
>209405 MicrobesOnline__882:209405
MASPALSPDEPDEPGVSGESGASGEPGASTSRQTRLRVKVCGLTRQEDAASCARLGVHLG
GFIFHASSPRNVDPACVADMDTGRMLRVGVFVRQSVDEVVRTMRVARLHMAQLHGGQDVA
FCKELVAALADILPEVLSGMSPSSGGEHADSPHDMARGRLLRAVWPARHATTVSFEHELA
TLAPYVGHFVFDAGTAGGGHGATLPWDALEGMSCPRPWLLAGGLGPDNVERAVRACHPWG
VDLNSGVESAPGIKDMQRIENALVALAACGDVSGPEARIGDARS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory