SitesBLAST
Comparing 209406 MicrobesOnline__882:209406 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ey5B Lbcats
60% identity, 96% coverage: 4:383/395 of query aligns to 1:381/383 of 5ey5B
- binding pyridoxal-5'-phosphate: H81 (= H83), K82 (= K84), Q109 (= Q111), S185 (≠ T187), G227 (= G229), G229 (= G231), S230 (= S232), N231 (= N233), E345 (= E347), S371 (= S373), G372 (= G374)
5dw0A Trpb from pyrococcus furiosus with l-serine bound as the external aldimine (see paper)
57% identity, 96% coverage: 5:383/395 of query aligns to 2:381/388 of 5dw0A
- active site: K82 (= K84), E104 (= E106), S371 (= S373)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H81 (= H83), K82 (= K84), T105 (= T107), G106 (= G108), A107 (= A109), Q109 (= Q111), H110 (= H112), S185 (≠ T187), G227 (= G229), G229 (= G231), S230 (= S232), N231 (= N233), G298 (= G300), D300 (= D302), E345 (= E347), S371 (= S373)
5t6mB Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
57% identity, 96% coverage: 5:383/395 of query aligns to 2:381/386 of 5t6mB
1v8zA X-ray crystal structure of the tryptophan synthase b2 subunit from hyperthermophile, pyrococcus furiosus (see paper)
57% identity, 96% coverage: 5:383/395 of query aligns to 2:381/386 of 1v8zA
- active site: K82 (= K84), E104 (= E106), S371 (= S373)
- binding pyridoxal-5'-phosphate: H81 (= H83), K82 (= K84), Q109 (= Q111), S185 (≠ T187), G227 (= G229), G228 (= G230), G229 (= G231), S230 (= S232), N231 (= N233), E345 (= E347), S371 (= S373), G372 (= G374)
6am8B Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9 with trp bound as e(aex2) (see paper)
58% identity, 96% coverage: 5:383/395 of query aligns to 2:381/385 of 6am8B
- active site: K82 (= K84), E104 (= E106), S371 (= S373)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-l-tryptophane: H81 (= H83), K82 (= K84), E104 (= E106), T105 (= T107), G106 (= G108), A107 (= A109), Q109 (= Q111), H110 (= H112), L161 (= L163), S185 (≠ T187), V187 (≠ A189), G227 (= G229), G228 (= G230), G229 (= G231), S230 (= S232), N231 (= N233), G298 (= G300), Y301 (= Y303), E345 (= E347), S371 (= S373), G372 (= G374)
- binding tryptophan: P12 (= P15), L169 (= L171), S274 (≠ L276), H275 (= H277)
6usaB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk1-bound form (see paper)
60% identity, 96% coverage: 4:381/395 of query aligns to 13:394/404 of 6usaB
- active site: K97 (= K84), E119 (= E106), S386 (= S373)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H83), K97 (= K84), T120 (= T107), G121 (= G108), A122 (= A109), G123 (= G110), Q124 (= Q111), H125 (= H112), T200 (= T187), G242 (= G229), G244 (= G231), S245 (= S232), N246 (= N233), G313 (= G300), E360 (= E347), S386 (= S373)
- binding (3R,4R)-4-[4-(2-Chlorophenyl)piperazin-1-yl]-1,1-dioxothiolan-3-ol: F184 (≠ L171), W187 (= W174), Y196 (= Y183), F198 (= F185), G203 (= G190), P204 (= P191), F207 (= F194), H290 (= H277), G291 (= G278)
6dweB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and brd0059-bound form
60% identity, 96% coverage: 4:381/395 of query aligns to 13:394/404 of 6dweB
- active site: K97 (= K84), E119 (= E106), S386 (= S373)
- binding (2R,3S,4R)-3-(2',6'-difluoro-4'-methyl[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: F184 (≠ L171), Y196 (= Y183), F198 (= F185), P204 (= P191), F207 (= F194), H290 (= H277)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H83), K97 (= K84), T120 (= T107), G121 (= G108), A122 (= A109), G123 (= G110), Q124 (= Q111), H125 (= H112), T200 (= T187), G242 (= G229), G244 (= G231), S245 (= S232), N246 (= N233), G313 (= G300), E360 (= E347), S386 (= S373)
6uapB Crystal structure of tryptophan synthase from m. Tuberculosis - open form with brd6309 bound
60% identity, 96% coverage: 4:381/395 of query aligns to 13:394/405 of 6uapB
- active site: K97 (= K84), E119 (= E106), S386 (= S373)
- binding (2R,3S,4R)-3-(4'-chloro-2',6'-difluoro[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: I180 (= I167), N181 (= N168), F184 (≠ L171), Y196 (= Y183), F198 (= F185), P204 (= P191), F207 (= F194), H290 (= H277)
5ocwB Structure of mycobacterium tuberculosis tryptophan synthase in space group f222 (see paper)
60% identity, 96% coverage: 4:381/395 of query aligns to 9:390/399 of 5ocwB
- active site: K93 (= K84), E115 (= E106), S382 (= S373)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H92 (= H83), K93 (= K84), T116 (= T107), G117 (= G108), A118 (= A109), Q120 (= Q111), H121 (= H112), T196 (= T187), G238 (= G229), G240 (= G231), S241 (= S232), N242 (= N233), G309 (= G300), E356 (= E347), S382 (= S373)
6u6cB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk2-bound form (see paper)
60% identity, 96% coverage: 4:381/395 of query aligns to 14:395/405 of 6u6cB
- active site: K98 (= K84), E120 (= E106), S387 (= S373)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H97 (= H83), K98 (= K84), T121 (= T107), G122 (= G108), A123 (= A109), Q125 (= Q111), H126 (= H112), T201 (= T187), G243 (= G229), G245 (= G231), S246 (= S232), N247 (= N233), G314 (= G300), E361 (= E347), S387 (= S373)
- binding 1-(2-fluorobenzene-1-carbonyl)-N-methyl-2,3-dihydro-1H-indole-5-sulfonamide: Y26 (≠ F13), F185 (≠ L171), W188 (= W174), Y197 (= Y183), F199 (= F185), G204 (= G190), P205 (= P191), H291 (= H277), G292 (= G278)
5tciH Crystal structure of tryptophan synthase from m. Tuberculosis - brd4592-bound form (see paper)
60% identity, 96% coverage: 4:381/395 of query aligns to 14:395/406 of 5tciH
- active site: K98 (= K84), E120 (= E106), S387 (= S373)
- binding (2R,3S,4R)-3-(2'-fluoro[1,1'-biphenyl]-4-yl)-4-(hydroxymethyl)azetidine-2-carbonitrile: P28 (= P15), L31 (= L18), Y197 (= Y183), F199 (= F185), P205 (= P191), F208 (= F194), H291 (= H277)
5dw3A Tryptophan synthase beta-subunit from pyrococcus furiosus with product l-tryptophan non-covalently bound in the active site (see paper)
57% identity, 96% coverage: 5:383/395 of query aligns to 2:380/383 of 5dw3A
- active site: K82 (= K84), E104 (= E106), S370 (= S373)
- binding tryptophan: K82 (= K84), E104 (= E106), T105 (= T107), G106 (= G108), A107 (= A109), Q109 (= Q111), H110 (= H112), S185 (≠ T187), G228 (= G230), Y300 (= Y303)
7rnpA Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound (see paper)
57% identity, 96% coverage: 5:383/395 of query aligns to 2:381/384 of 7rnpA
5ixjD Tryptophan synthase beta-subunit from pyrococcus furiosus with l- threonine non-covalently bound in the active site (see paper)
57% identity, 96% coverage: 5:383/395 of query aligns to 2:379/394 of 5ixjD
5t6mA Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
57% identity, 96% coverage: 5:383/395 of query aligns to 2:379/383 of 5t6mA
5vm5D Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9, with ser bound (see paper)
58% identity, 96% coverage: 5:383/395 of query aligns to 2:379/383 of 5vm5D
- active site: K82 (= K84), E104 (= E106), S369 (= S373)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H83), K82 (= K84), T105 (= T107), G106 (= G108), A107 (= A109), Q109 (= Q111), H110 (= H112), S185 (≠ T187), G227 (= G229), G229 (= G231), S230 (= S232), N231 (= N233), G296 (= G300), E343 (= E347), S369 (= S373)
6cuzA Engineered trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3r)- ethylserine bound as the amino-acrylate (see paper)
57% identity, 96% coverage: 5:383/395 of query aligns to 2:381/383 of 6cuzA
- binding (2E)-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]pent-2-enoic acid: H81 (= H83), K82 (= K84), T105 (= T107), G106 (= G108), A107 (= A109), Q109 (= Q111), H110 (= H112), S185 (≠ T187), G227 (= G229), G229 (= G231), S230 (= S232), N231 (= N233), G298 (= G300), E345 (= E347), S371 (= S373)
6cutA Engineered holo trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3s)- isopropylserine bound as the external aldimine (see paper)
57% identity, 96% coverage: 5:383/395 of query aligns to 2:381/385 of 6cutA
- binding (2S,3S)-3-hydroxy-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-4-methylpentanoic acid (non-preferred name): H81 (= H83), K82 (= K84), T105 (= T107), G106 (= G108), A107 (= A109), Q109 (= Q111), H110 (= H112), S185 (≠ T187), G227 (= G229), G229 (= G231), S230 (= S232), N231 (= N233), G298 (= G300), E345 (= E347), S371 (= S373)
5kzmB Crystal structure of tryptophan synthase alpha-beta chain complex from francisella tularensis (see paper)
56% identity, 96% coverage: 5:385/395 of query aligns to 7:392/395 of 5kzmB
8egzB Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate
57% identity, 98% coverage: 3:388/395 of query aligns to 1:382/386 of 8egzB
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H83), K82 (= K84), T105 (= T107), G106 (= G108), A107 (= A109), Q109 (= Q111), H110 (= H112), S185 (≠ T187), G229 (= G231), S230 (= S232), N231 (= N233), G297 (= G300), E344 (= E347), S367 (= S373)
Query Sequence
>209406 MicrobesOnline__882:209406
MKKGYFGDFGGRFVPELLMPPLMEIEAAMRDIMPTQAFRHELDDLLHNFAGRETPLTRCD
TLSRELGCTLWLKREDLLHTGAHKVNNTLGQALLARRMGKTRLVAETGAGQHGVATAAAA
ARLGLSCIVFMGAVDVERQSANVMRMKLLGAEVVPVESGTRTLKDAINETLRYWIAEQGS
THYCFGTAAGPHPFPTLVRDFQAVIGHETRRQMLERTGALPDMVVACVGGGSNAIGMFHA
FVDDADVRIVGVEAAGTGEPGCYNSAPINLGSPGVLHGNRTMLLQDGDGQILPSHSVSAG
LDYPGVGPEHAHLGATGRVVYGMVTDTQALAAFKALTRAEGIIPALESSHAVAWVLENPH
LLPQGGNVVVNLSGRGDKDMDIVREHLFPSLGGKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory