Comparing 209435 MicrobesOnline__882:209435 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7bkcK Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (dimeric, composite structure) (see paper)
37% identity, 21% coverage: 319:424/501 of query aligns to 13:95/321 of 7bkcK
Sites not aligning to the query:
7bkbK Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) (see paper)
37% identity, 21% coverage: 319:424/501 of query aligns to 13:95/386 of 7bkbK
Sites not aligning to the query:
7bkbL Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) (see paper)
30% identity, 18% coverage: 339:427/501 of query aligns to 7:78/79 of 7bkbL
8e9iI Mycobacterial respiratory complex i, semi-inserted quinone (see paper)
36% identity, 17% coverage: 341:423/501 of query aligns to 50:114/166 of 8e9iI
Sites not aligning to the query:
>209435 MicrobesOnline__882:209435
MMTARTDAARGTSRPATLAVNVHTTYTTRQHDTWGRHTLSPARHTTGRHMGHLTGKDVYR
RLAGKLDNTPVRTPDTPAFRALLRELYTPEEADLVACMPYRPATASRIAAVCRMGRARVE
AMLDTLCAKGLVIDLREGDTATYMISPIVIGIFEFTMMRTGGDLPHGTWARLFNDYMFGD
TTFFDANFASGQRISIMRALPHEEAVEEAARTEILDHERARALVDRHTTFAVGLCSCRHE
KVHIGEEPCDAPLETCTSLGSGAEFLIRNGFARRIDRAEMLDILARSRDLGLTLSTDNVR
RDAGFICHCCGCCCNLMRGIKVTGHTGILVTSNWLATCDADACTGCGLCVRACPVDALHV
VRKDGQRTASNETVDARGDVPDDEAASSTARRGKARRRLEVDTSVCLGCGVCALRCPTGA
LRLEERPARVFHPEDSFERVILQSLERGTFQNLIFDNPASRSQAFMRGLVGGFLRLDPVK
RALMGDRLRSRFLGAIRRVAT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory