SitesBLAST
Comparing 209474 MicrobesOnline__882:209474 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1kqfB Formate dehydrogenase n from e. Coli (see paper)
33% identity, 55% coverage: 36:237/370 of query aligns to 25:226/289 of 1kqfB
- binding protoporphyrin ix containing fe: Y137 (= Y147)
- binding iron/sulfur cluster: K31 (≠ V42), C38 (= C49), I39 (= I50), G40 (= G51), C41 (= C52), K42 (≠ R53), C44 (= C55), C48 (= C59), N52 (= N63), T77 (= T90), M79 (≠ V92), C99 (= C110), M100 (≠ N111), H101 (= H112), C102 (= C113), P105 (= P116), C107 (= C118), C111 (= C122), P112 (vs. gap), I117 (≠ F127), V125 (= V135), C132 (= C142), I133 (≠ V143), G134 (= G144), C135 (= C145), G136 (≠ R146), Y137 (= Y147), C138 (= C148), C142 (= C152), I146 (≠ V156), P147 (= P157), V156 (≠ I169), K158 (= K171), C159 (= C172), L161 (≠ M174), C162 (= C175), P172 (= P185), C174 (= C187), C178 (= C191), P179 (= P192), I183 (≠ L196)
Sites not aligning to the query:
P0AAJ3 Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit; Anaerobic formate dehydrogenase iron-sulfur subunit; Formate dehydrogenase-N subunit beta; FDH-N subunit beta from Escherichia coli (strain K12) (see paper)
33% identity, 55% coverage: 36:237/370 of query aligns to 26:227/294 of P0AAJ3
- C39 (= C49) binding
- C42 (= C52) binding
- C45 (= C55) binding
- C49 (= C59) binding
- C100 (= C110) binding
- C103 (= C113) binding
- C108 (= C118) binding
- C112 (= C122) binding
- C133 (= C142) binding
- C136 (= C145) binding
- C139 (= C148) binding
- C143 (= C152) binding
- C160 (= C172) binding
- C163 (= C175) binding
- C175 (= C187) binding
- C179 (= C191) binding
P18776 Anaerobic dimethyl sulfoxide reductase chain B; DMSO reductase iron-sulfur subunit from Escherichia coli (strain K12) (see 2 papers)
36% identity, 45% coverage: 40:204/370 of query aligns to 5:158/205 of P18776
- C102 (= C145) mutation C->F,S,W,Y: Loss of electron transfer from menaquinol to DMSO.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2vpyF Polysulfide reductase with bound quinone inhibitor, pentachlorophenol (pcp) (see paper)
32% identity, 44% coverage: 40:203/370 of query aligns to 4:147/193 of 2vpyF
- binding pentachlorophenol: I91 (≠ V143), C93 (= C145)
- binding iron/sulfur cluster: C13 (= C49), G15 (= G51), C16 (= C52), C19 (= C55), C23 (= C59), N27 (= N63), L36 (= L75), I38 (≠ V77), P55 (≠ K107), Q57 (= Q109), C58 (= C110), L59 (≠ N111), C61 (= C113), P65 (≠ A117), C66 (= C118), C70 (= C122), P71 (≠ F123), V83 (= V135), C90 (= C142), I91 (≠ V143), A92 (≠ G144), C93 (= C145), G94 (≠ R146), C96 (= C148), C100 (= C152), P101 (= P153), Y102 (≠ F154), R105 (≠ P157), V113 (≠ I169), C116 (= C172), F118 (≠ M174), C119 (= C175), P129 (= P185), A130 (≠ G186), C131 (= C187), C135 (= C191), C139 (≠ A195), R140 (≠ L196)
Sites not aligning to the query:
2vpwF Polysulfide reductase with bound menaquinone (see paper)
32% identity, 44% coverage: 40:203/370 of query aligns to 4:147/193 of 2vpwF
- binding iron/sulfur cluster: C13 (= C49), G15 (= G51), C16 (= C52), C19 (= C55), C23 (= C59), N27 (= N63), L36 (= L75), I38 (≠ V77), P55 (≠ K107), Q57 (= Q109), C58 (= C110), L59 (≠ N111), H60 (= H112), C61 (= C113), P65 (≠ A117), C66 (= C118), C70 (= C122), P71 (≠ F123), V83 (= V135), C90 (= C142), I91 (≠ V143), A92 (≠ G144), C93 (= C145), G94 (≠ R146), C96 (= C148), C100 (= C152), P101 (= P153), Y102 (≠ F154), R105 (≠ P157), V113 (≠ I169), C116 (= C172), F118 (≠ M174), C119 (= C175), P129 (= P185), A130 (≠ G186), C131 (= C187), C135 (= C191), C139 (≠ A195), R140 (≠ L196)
Sites not aligning to the query:
6f0kB Alternative complex iii (see paper)
28% identity, 50% coverage: 36:219/370 of query aligns to 720:933/961 of 6f0kB
- binding fe3-s4 cluster: C803 (= C122), V805 (= V124), M818 (≠ Y137), C823 (= C142), I824 (≠ V143), G825 (= G144), C829 (= C148), M869 (≠ I169)
- binding heme c: N821 (≠ S140), R822 (≠ L141), R884 (vs. gap), N887 (vs. gap)
- binding iron/sulfur cluster: C733 (= C49), T734 (≠ I50), G735 (= G51), C736 (= C52), N737 (≠ R53), A738 (≠ K54), C739 (= C55), C743 (= C59), W765 (= W89), I768 (≠ V92), C791 (= C110), M792 (≠ N111), H793 (= H112), C794 (= C113), P798 (≠ A117), C799 (= C118), N816 (≠ V135), C833 (= C152), C872 (= C172), Y874 (≠ M174), C875 (= C175), A901 (≠ G186), C902 (= C187), C906 (= C191)
Sites not aligning to the query:
8cm6D W-formate dehydrogenase c872a from desulfovibrio vulgaris - with formamide (see paper)
28% identity, 52% coverage: 45:236/370 of query aligns to 7:201/214 of 8cm6D
- binding formamide: R59 (≠ Y95), P62 (≠ A98)
- binding iron/sulfur cluster: C11 (= C49), T12 (≠ I50), A13 (≠ G51), C14 (= C52), R15 (= R53), C17 (= C55), C21 (= C59), K25 (≠ N63), K50 (= K80), C73 (= C110), R74 (≠ N111), C76 (= C113), P79 (= P116), P80 (≠ A117), C81 (= C118), V102 (= V135), C120 (= C152), I124 (≠ V156), P125 (= P157), K136 (= K171), C137 (= C172), D138 (≠ T173), M139 (= M174), C140 (= C175), C152 (= C187), C156 (= C191), P157 (= P192), T158 (≠ K193), T160 (≠ A195), M161 (≠ L196)
Sites not aligning to the query:
8bqgB W-formate dehydrogenase from desulfovibrio vulgaris - soaking with formate 1 min (see paper)
28% identity, 52% coverage: 45:236/370 of query aligns to 7:201/214 of 8bqgB
- binding iron/sulfur cluster: C11 (= C49), T12 (≠ I50), A13 (≠ G51), C14 (= C52), R15 (= R53), C17 (= C55), C21 (= C59), K25 (≠ N63), K50 (= K80), C73 (= C110), R74 (≠ N111), C76 (= C113), P80 (≠ A117), C81 (= C118), V102 (= V135), C120 (= C152), I124 (≠ V156), P125 (= P157), K136 (= K171), C137 (= C172), M139 (= M174), C140 (= C175), C152 (= C187), C156 (= C191), P157 (= P192), T158 (≠ K193), T160 (≠ A195), M161 (≠ L196)
Sites not aligning to the query:
2ivfB Ethylbenzene dehydrogenase from aromatoleum aromaticum (see paper)
34% identity, 30% coverage: 104:214/370 of query aligns to 130:238/337 of 2ivfB
- binding fe3-s4 cluster: C148 (= C122), T150 (≠ V124), I153 (≠ F127), C169 (= C142), K170 (≠ V143), G171 (= G144), H172 (≠ C145), R173 (= R146), H174 (≠ Y147), C175 (= C148), S193 (vs. gap)
- binding protoporphyrin ix containing fe: T150 (≠ V124), K170 (≠ V143), H172 (≠ C145)
- binding iron/sulfur cluster: M135 (≠ Q109), C136 (= C110), N137 (= N111), H138 (= H112), C139 (= C113), P142 (= P116), C144 (= C118), V162 (= V135), C179 (= C152), A183 (= A162), I184 (≠ E163), K195 (= K171), C196 (= C172), I197 (≠ T173), L198 (≠ M174), C199 (= C175), N209 (≠ P185), C211 (= C187), C215 (= C191), V219 (≠ A195), R220 (≠ L196)
Sites not aligning to the query:
- binding iron/sulfur cluster: 13, 14, 15, 16, 17, 19, 23, 27, 38, 39, 41
5ch7B Crystal structure of the perchlorate reductase pcrab - phe164 gate switch intermediate - from azospira suillum ps (see paper)
32% identity, 30% coverage: 105:214/370 of query aligns to 128:235/329 of 5ch7B
- binding fe3-s4 cluster: C145 (= C122), I150 (vs. gap), C166 (= C142), K167 (≠ V143), G168 (= G144), A169 (≠ C145), Q170 (≠ R146), A171 (≠ Y147), C172 (= C148), A190 (vs. gap)
- binding iron/sulfur cluster: P130 (≠ K107), C133 (= C110), N134 (= N111), C136 (= C113), P139 (= P116), C141 (= C118), C176 (= C152), C193 (= C172), G195 (≠ M174), C196 (= C175), C208 (= C187), C212 (= C191), V213 (≠ P192), G214 (≠ K193)
Sites not aligning to the query:
7qv7B Cryo-em structure of hydrogen-dependent co2 reductase. (see paper)
31% identity, 42% coverage: 42:198/370 of query aligns to 7:161/183 of 7qv7B
- binding iron/sulfur cluster: C14 (= C49), G16 (= G51), C17 (= C52), K18 (≠ R53), A19 (≠ K54), C20 (= C55), C24 (= C59), H28 (≠ N63), R48 (= R94), C63 (= C110), R64 (≠ N111), H65 (= H112), C66 (= C113), A69 (≠ P116), C71 (= C118), C75 (= C122), A79 (= A126), I80 (≠ F127), C94 (= C142), I95 (≠ V143), C97 (= C145), C100 (= C148), C104 (= C152), I109 (vs. gap), C139 (= C172), L141 (≠ M174), C142 (= C175), P148 (= P185), C150 (= C187), C154 (= C191), P155 (= P192), L159 (= L196)
Q8GC87 Formate dehydrogenase subunit beta; FDH subunit beta; Formate dehydrogenase small subunit from Megalodesulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759) (Desulfovibrio gigas) (see paper)
27% identity, 49% coverage: 39:221/370 of query aligns to 2:187/215 of Q8GC87
- C12 (= C49) binding
- C15 (= C52) binding
- C18 (= C55) binding
- C22 (= C59) binding
- C73 (= C110) binding
- C76 (= C113) binding
- C81 (= C118) binding
- C121 (= C152) binding
- C138 (= C172) binding
- C141 (= C175) binding
- C153 (= C187) binding
- C157 (= C191) binding
1h0hB Tungsten containing formate dehydrogenase from desulfovibrio gigas (see paper)
27% identity, 49% coverage: 39:221/370 of query aligns to 1:186/214 of 1h0hB
- binding iron/sulfur cluster: F4 (≠ V42), C11 (= C49), T12 (≠ I50), A13 (≠ G51), C14 (= C52), R15 (= R53), C17 (= C55), C21 (= C59), H25 (≠ N63), K50 (≠ T90), Q71 (= Q109), C72 (= C110), R73 (≠ N111), C75 (= C113), P79 (≠ A117), C80 (= C118), V101 (= V143), C120 (= C152), P125 (= P157), K136 (= K171), C137 (= C172), D138 (≠ T173), M139 (= M174), C140 (= C175), C152 (= C187), C156 (= C191), P157 (= P192), A160 (= A195)
7z0sB Structure of the escherichia coli formate hydrogenlyase complex (anaerobic preparation, without formate dehydrogenase h) (see paper)
33% identity, 34% coverage: 42:166/370 of query aligns to 5:106/170 of 7z0sB
- binding iron/sulfur cluster: C12 (= C49), I13 (= I50), G14 (= G51), C15 (= C52), H16 (≠ R53), T17 (≠ K54), C18 (= C55), C22 (= C59), H26 (≠ N63), R36 (≠ K80), L37 (≠ T81), P48 (≠ K107), L50 (≠ Q109), C51 (= C110), H52 (≠ N111), H53 (= H112), C54 (= C113), C59 (= C118), C63 (= C122), P64 (≠ F123), I68 (≠ F127), V75 (= V135), L77 (≠ Y137), C82 (= C142), V83 (= V143), C85 (= C145), K86 (≠ R146), C88 (= C148), C92 (= C152), I97 (≠ P157)
Sites not aligning to the query:
- binding iron/sulfur cluster: 140, 142, 143, 144, 145, 146, 153, 155, 159, 160, 161, 164
3egwB The crystal structure of the narghi mutant narh - c16a
33% identity, 24% coverage: 104:191/370 of query aligns to 178:263/509 of 3egwB
- binding fe3-s4 cluster: P181 (≠ K107), C196 (= C122), S198 (≠ V124), I201 (vs. gap), C217 (= C142), R218 (≠ V143), G219 (= G144), W220 (≠ C145), R221 (= R146), C223 (= C148), S241 (≠ D166), C263 (= C191)
- binding protoporphyrin ix containing fe: W220 (≠ C145), R221 (= R146)
- binding iron/sulfur cluster: C184 (= C110), E185 (≠ N111), H186 (= H112), C187 (= C113), P190 (= P116), C192 (= C118), C227 (= C152), I232 (≠ P157), K243 (= K171), C244 (= C172), F246 (≠ M174), C247 (= C175), T257 (≠ P185), C259 (= C187)
Sites not aligning to the query:
- binding fe3-s4 cluster: 17, 18, 19, 20, 22, 265, 268
- binding protoporphyrin ix containing fe: 88, 89
- binding iron/sulfur cluster: 26, 30, 41, 42
P11349 Respiratory nitrate reductase 1 beta chain; Nitrate reductase A subunit beta; Quinol-nitrate oxidoreductase subunit beta; EC 1.7.5.1 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 24% coverage: 104:191/370 of query aligns to 178:263/512 of P11349
- C184 (= C110) binding
- C187 (= C113) binding
- C192 (= C118) binding
- C196 (= C122) binding
- C217 (= C142) binding
- C223 (= C148) binding
- C227 (= C152) binding
- C244 (= C172) binding
- C247 (= C175) binding
- C259 (= C187) binding
- C263 (= C191) binding
Sites not aligning to the query:
- 16 binding
- 19 binding
- 22 binding
- 26 binding
6cz7B The arsenate respiratory reductase (arr) complex from shewanella sp. Ana-3 (see paper)
25% identity, 44% coverage: 41:203/370 of query aligns to 4:195/234 of 6cz7B
- binding iron/sulfur cluster: C12 (= C49), V13 (≠ I50), G14 (= G51), C15 (= C52), G16 (≠ R53), C18 (= C55), C22 (= C59), N26 (= N63), Y52 (≠ F105), P54 (≠ K107), C57 (= C110), N58 (= N111), H59 (= H112), C60 (= C113), A63 (≠ P116), P64 (≠ A117), C65 (= C118), C69 (= C122), P70 (≠ F123), T82 (≠ V135), C89 (= C142), I90 (≠ V143), G91 (= G144), C92 (= C145), K93 (≠ R146), C95 (= C148), C99 (= C152), Y101 (≠ F154), V103 (= V156), I104 (≠ P157), T161 (vs. gap), K163 (= K171), C164 (= C172), F166 (≠ M174), C167 (= C175), C179 (= C187), C183 (= C191), P184 (= P192), R188 (≠ L196)
Q7WTT9 Arsenate respiratory reductase iron-sulfur subunit ArrB; Arsenate respiratory reductase small subunit; ARR small subunit from Shewanella sp. (strain ANA-3) (see paper)
25% identity, 44% coverage: 41:203/370 of query aligns to 4:195/234 of Q7WTT9
- C12 (= C49) binding
- C15 (= C52) binding
- C18 (= C55) binding
- C22 (= C59) binding
- C57 (= C110) binding
- C60 (= C113) binding
- C65 (= C118) binding
- C69 (= C122) binding
- C89 (= C142) binding
- C92 (= C145) binding
- C95 (= C148) binding
- C99 (= C152) binding
- C164 (= C172) binding
- C167 (= C175) binding
- C179 (= C187) binding
- C183 (= C191) binding
7qv7A Cryo-em structure of hydrogen-dependent co2 reductase. (see paper)
26% identity, 50% coverage: 42:225/370 of query aligns to 5:174/174 of 7qv7A
- binding iron/sulfur cluster: C12 (= C49), L13 (≠ I50), G14 (= G51), C15 (= C52), Y16 (≠ R53), C18 (= C55), C22 (= C59), H26 (≠ N63), L37 (≠ A70), C51 (= C110), R52 (≠ N111), C54 (= C113), C59 (= C118), C63 (= C122), C82 (= C142), I83 (≠ V143), G84 (= G144), C85 (= C145), C88 (= C148), C92 (= C152), I97 (≠ P157), F99 (= F159), C125 (= C172), L127 (≠ M174), C128 (= C175), A136 (≠ G186), C137 (= C187), C141 (= C191)
6lodB Cryo-em structure of the air-oxidized photosynthetic alternative complex iii from roseiflexus castenholzii (see paper)
22% identity, 46% coverage: 33:203/370 of query aligns to 678:887/929 of 6lodB
- binding fe3-s4 cluster: V758 (≠ A121), C759 (= C122), P760 (≠ F123), C779 (= C142), V780 (= V143), G781 (= G144), T782 (≠ C145), C785 (= C148), M838 (≠ I169)
- binding heme c: N777 (≠ S140), R778 (≠ L141), R852 (≠ K183), I853 (vs. gap), R856 (vs. gap)
- binding iron/sulfur cluster: C692 (= C49), N693 (≠ I50), S694 (≠ G51), C695 (= C52), N696 (≠ R53), A697 (≠ K54), C698 (= C55), C702 (= C59), N706 (= N63), W724 (≠ R83), I727 (≠ A86), L746 (≠ R106), C747 (≠ K107), Q748 (= Q108), Q749 (= Q109), C750 (= C110), P754 (≠ A117), C755 (= C118), N772 (≠ V135), C789 (= C152), Y791 (≠ F154), V793 (= V156), R794 (≠ P157), K840 (= K171), C841 (= C172), F843 (≠ M174), C844 (= C175), T869 (≠ P185), C871 (= C187), C875 (= C191), I880 (≠ L196)
Query Sequence
>209474 MicrobesOnline__882:209474
MDRRRFLTLLGSAGLTATVATAGTAKAASTGTFPGYKDSYGVLHDTTRCIGCRKCEQACN
EVNKLPAPKAKFDDLTVLEKTRRTDADSWTVVNRYNAAGLDHPVFRKQQCNHCLEPACAS
ACFVKAFTKNPDGSVTYDGSLCVGCRYCMVACPFNVPAFQYAEAFDPLIQKCTMCHPRLA
EGKLPGCVEICPKEALTFGRRKDLVRIAHDRIRQNPGRYIDHVYGEQEMGGTAWMYLSGV
PFSATGMNEELGTKSAPEYTAGALGAVPMVVGIWPILLTGAYAITKRKEKIAAEEQAEAV
KQAVAASRAEADDKLKAALAKADKDKEAAVTREVKKAVDEARKTFEEELAAKEQPEAPEG
DDAGKPGEDA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory