SitesBLAST – Find functional sites

 

SitesBLAST

Comparing 209474 MicrobesOnline__882:209474 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 20 (the maximum) hits to proteins with known functional sites (download)

1kqfB Formate dehydrogenase n from e. Coli (see paper)
33% identity, 55% coverage: 36:237/370 of query aligns to 25:226/289 of 1kqfB

query
sites
1kqfB
Y
 
Y
K
 
K
D
 
A
S
 
E
Y
 
V
G
 
A
V
x
K
L
 
L
H
 
I
D
 
D
T
 
V
T
 
S
R
 
T
C
|
C
I
|
I
G
|
G
C
|
C
R
x
K
K
 
A
C
|
C
E
 
Q
Q
 
V
A
 
A
C
|
C
N
 
S
E
 
E
V
 
W
N
|
N
K
 
D
L
 
I
P
 
R
A
 
D
P
 
E
K
 
V
A
 
G
K
 
H
F
 
C
D
 
-
D
 
-
L
 
V
T
 
G
V
 
V
L
 
Y
E
 
D
K
 
N
T
 
P
R
 
A
R
 
D
T
 
L
D
 
S
A
 
A
D
 
K
S
 
S
W
 
W
T
|
T
V
 
V
V
x
M
-
 
R
-
 
F
N
 
S
R
 
E
Y
 
T
N
 
E
A
 
Q
A
 
N
G
 
G
L
 
K
D
 
L
H
 
E
P
 
W
V
 
L
F
 
I
R
 
R
K
 
K
Q
 
D
Q
 
G
C
|
C
N
x
M
H
|
H
C
|
C
L
 
E
E
 
D
P
|
P
A
 
G
C
|
C
A
 
L
S
 
K
A
 
A
C
|
C
-
x
P
F
 
S
V
 
A
K
 
G
A
 
A
F
x
I
T
 
I
K
 
Q
N
 
Y
P
 
A
D
 
N
G
 
G
S
 
I
V
|
V
T
 
D
Y
 
F
D
 
Q
G
 
S
S
 
E
L
 
N
C
|
C
V
x
I
G
|
G
C
|
C
R
x
G
Y
|
Y
C
|
C
M
 
I
V
 
A
A
 
G
C
|
C
P
 
P
F
 
F
N
 
N
V
x
I
P
|
P
A
 
R
F
 
L
Q
 
N
Y
 
K
A
 
E
E
 
-
A
 
-
F
 
-
D
 
D
P
 
N
L
 
R
I
x
V
Q
 
Y
K
|
K
C
|
C
T
 
T
M
x
L
C
|
C
H
 
V
P
 
D
R
 
R
L
 
V
A
 
S
E
 
V
G
 
G
K
 
Q
L
 
E
P
|
P
G
 
A
C
|
C
V
 
V
E
 
K
I
 
T
C
|
C
P
|
P
K
 
T
E
 
G
A
 
A
L
x
I
T
 
H
F
 
F
G
 
G
R
 
T
R
 
K
K
 
K
D
 
E
L
 
M
V
 
L
R
 
E
I
 
L
A
 
A
H
 
E
D
 
Q
R
 
R
I
 
V
R
 
A
Q
 
K
N
 
L
P
 
K
G
 
A
R
 
R
Y
 
G
I
 
Y
D
 
E
H
 
H
-
 
A
-
 
G
V
 
V
Y
 
Y
G
 
N
E
 
P
Q
 
E
E
 
G
M
 
V
G
 
G
G
 
G
T
 
T
A
 
H
W
 
V
M
 
M
Y
 
Y
L
 
V

Sites not aligning to the query:

P0AAJ3 Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit; Anaerobic formate dehydrogenase iron-sulfur subunit; Formate dehydrogenase-N subunit beta; FDH-N subunit beta from Escherichia coli (strain K12) (see paper)
33% identity, 55% coverage: 36:237/370 of query aligns to 26:227/294 of P0AAJ3

query
sites
P0AAJ3
Y
 
Y
K
 
K
D
 
A
S
 
E
Y
 
V
G
 
A
V
 
K
L
 
L
H
 
I
D
 
D
T
 
V
T
 
S
R
 
T
C
|
C
I
 
I
G
 
G
C
|
C
R
 
K
K
 
A
C
|
C
E
 
Q
Q
 
V
A
 
A
C
|
C
N
 
S
E
 
E
V
 
W
N
 
N
K
 
D
L
 
I
P
 
R
A
 
D
P
 
E
K
 
V
A
 
G
K
 
H
F
 
C
D
 
-
D
 
-
L
 
V
T
 
G
V
 
V
L
 
Y
E
 
D
K
 
N
T
 
P
R
 
A
R
 
D
T
 
L
D
 
S
A
 
A
D
 
K
S
 
S
W
 
W
T
 
T
V
 
V
V
 
M
-
 
R
-
 
F
N
 
S
R
 
E
Y
 
T
N
 
E
A
 
Q
A
 
N
G
 
G
L
 
K
D
 
L
H
 
E
P
 
W
V
 
L
F
 
I
R
 
R
K
 
K
Q
 
D
Q
 
G
C
|
C
N
 
M
H
 
H
C
|
C
L
 
E
E
 
D
P
 
P
A
 
G
C
|
C
A
 
L
S
 
K
A
 
A
C
|
C
-
 
P
F
 
S
V
 
A
K
 
G
A
 
A
F
 
I
T
 
I
K
 
Q
N
 
Y
P
 
A
D
 
N
G
 
G
S
 
I
V
 
V
T
 
D
Y
 
F
D
 
Q
G
 
S
S
 
E
L
 
N
C
|
C
V
 
I
G
 
G
C
|
C
R
 
G
Y
 
Y
C
|
C
M
 
I
V
 
A
A
 
G
C
|
C
P
 
P
F
 
F
N
 
N
V
 
I
P
 
P
A
 
R
F
 
L
Q
 
N
Y
 
K
A
 
E
E
 
-
A
 
-
F
 
-
D
 
D
P
 
N
L
 
R
I
 
V
Q
 
Y
K
 
K
C
|
C
T
 
T
M
 
L
C
|
C
H
 
V
P
 
D
R
 
R
L
 
V
A
 
S
E
 
V
G
 
G
K
 
Q
L
 
E
P
 
P
G
 
A
C
|
C
V
 
V
E
 
K
I
 
T
C
|
C
P
 
P
K
 
T
E
 
G
A
 
A
L
 
I
T
 
H
F
 
F
G
 
G
R
 
T
R
 
K
K
 
K
D
 
E
L
 
M
V
 
L
R
 
E
I
 
L
A
 
A
H
 
E
D
 
Q
R
 
R
I
 
V
R
 
A
Q
 
K
N
 
L
P
 
K
G
 
A
R
 
R
Y
 
G
I
 
Y
D
 
E
H
 
H
-
 
A
-
 
G
V
 
V
Y
 
Y
G
 
N
E
 
P
Q
 
E
E
 
G
M
 
V
G
 
G
G
 
G
T
 
T
A
 
H
W
 
V
M
 
M
Y
 
Y
L
 
V

P18776 Anaerobic dimethyl sulfoxide reductase chain B; DMSO reductase iron-sulfur subunit from Escherichia coli (strain K12) (see 2 papers)
36% identity, 45% coverage: 40:204/370 of query aligns to 5:158/205 of P18776

query
sites
P18776
Y
 
Y
G
 
G
V
 
F
L
 
F
H
 
I
D
 
D
T
 
S
T
 
S
R
 
R
C
 
C
I
 
T
G
 
G
C
 
C
R
 
K
K
 
T
C
 
C
E
 
E
Q
 
L
A
 
A
C
 
C
N
 
K
E
 
D
V
 
Y
N
 
K
K
 
D
L
 
L
P
 
-
A
 
T
P
 
P
K
 
E
A
 
V
K
 
S
F
 
F
D
 
-
D
 
-
L
 
-
T
 
-
V
 
-
L
 
-
E
 
R
K
 
R
T
 
I
R
 
Y
R
 
E
T
 
Y
D
 
A
A
 
G
D
 
G
S
 
D
W
 
W
T
 
Q
V
 
E
V
 
D
N
 
N
R
 
-
Y
 
-
N
 
-
A
 
-
A
 
-
G
 
G
L
 
V
D
 
W
H
 
H
P
 
Q
-
 
N
-
 
V
-
 
F
-
 
A
V
 
Y
F
 
Y
R
 
L
K
 
S
Q
 
I
Q
 
S
C
 
C
N
 
N
H
 
H
C
 
C
L
 
E
E
 
D
P
 
P
A
 
A
C
 
C
A
 
T
S
 
K
A
 
V
C
 
C
F
 
P
V
 
S
K
 
G
A
 
A
F
 
M
T
 
H
K
 
K
N
 
R
P
 
E
D
 
D
G
 
G
S
 
F
V
 
V
T
 
V
Y
 
V
D
 
D
G
 
E
S
 
D
L
 
V
C
 
C
V
 
I
G
 
G
C
|
C
R
 
R
Y
 
Y
C
 
C
M
 
H
V
 
M
A
 
A
C
 
C
P
 
P
F
 
Y
N
 
G
V
 
A
P
 
P
A
 
Q
F
 
Y
Q
 
N
Y
 
E
A
 
T
E
 
K
A
 
G
F
 
H
D
 
-
P
 
-
L
 
-
I
 
M
Q
 
T
K
 
K
C
 
C
T
 
D
M
 
G
C
 
C
H
 
Y
P
 
D
R
 
R
L
 
V
A
 
A
E
 
E
G
 
G
K
 
K
L
 
K
P
 
P
G
 
I
C
 
C
V
 
V
E
 
E
I
 
S
C
 
C
P
 
P
K
 
L
E
 
R
A
 
A
L
 
L
T
 
D
F
 
F
G
 
G
R
 
P
R
 
I
K
 
D
D
 
E
L
 
L

Sites not aligning to the query:

2vpyF Polysulfide reductase with bound quinone inhibitor, pentachlorophenol (pcp) (see paper)
32% identity, 44% coverage: 40:203/370 of query aligns to 4:147/193 of 2vpyF

query
sites
2vpyF
Y
 
Y
G
 
A
V
 
M
L
 
A
H
 
I
D
 
D
T
 
L
T
 
S
R
 
L
C
|
C
I
 
V
G
|
G
C
|
C
R
 
A
K
 
A
C
|
C
E
 
A
Q
 
V
A
 
A
C
|
C
N
 
K
E
 
M
V
 
E
N
|
N
K
 
E
L
 
V
P
 
P
A
 
P
P
 
-
K
 
-
A
 
-
K
 
G
F
 
V
D
 
F
D
 
N
L
|
L
T
 
W
V
x
I
L
 
R
E
 
E
K
 
R
T
 
E
R
 
-
R
 
-
T
 
-
D
 
-
A
 
-
D
 
-
S
 
-
W
 
-
T
 
-
V
 
-
V
 
V
N
 
G
R
 
E
Y
 
Y
N
 
P
A
 
N
A
 
L
G
 
V
L
 
V
D
 
E
H
 
-
P
 
-
V
 
-
F
 
F
R
 
R
K
x
P
Q
 
E
Q
|
Q
C
|
C
N
x
L
H
 
H
C
|
C
L
 
E
E
 
N
P
 
P
A
x
P
C
|
C
A
 
V
S
 
P
A
 
V
C
|
C
F
x
P
V
 
T
K
 
G
A
 
A
F
 
S
T
 
Y
K
 
Q
N
 
T
P
 
K
D
 
D
G
 
G
S
 
L
V
|
V
T
 
L
Y
 
V
D
 
D
G
 
P
S
 
K
L
 
K
C
|
C
V
x
I
G
x
A
C
|
C
R
x
G
Y
 
A
C
|
C
M
 
I
V
 
A
A
 
A
C
|
C
P
|
P
F
x
Y
N
 
D
V
 
A
P
x
R
A
 
Y
F
 
L
Q
 
H
Y
 
P
A
 
A
E
 
G
A
 
-
F
 
-
D
 
-
P
 
-
L
 
Y
I
x
V
Q
 
S
K
 
K
C
|
C
T
 
T
M
x
F
C
|
C
H
 
A
P
 
H
R
 
R
L
 
L
A
 
E
E
 
K
G
 
G
K
 
K
L
 
V
P
|
P
G
x
A
C
|
C
V
 
V
E
 
E
I
 
T
C
|
C
P
 
P
K
 
T
E
 
Y
A
x
C
L
x
R
T
 
T
F
 
F
G
 
G
R
 
D
R
 
L
K
 
E
D
 
D

Sites not aligning to the query:

2vpwF Polysulfide reductase with bound menaquinone (see paper)
32% identity, 44% coverage: 40:203/370 of query aligns to 4:147/193 of 2vpwF

query
sites
2vpwF
Y
 
Y
G
 
A
V
 
M
L
 
A
H
 
I
D
 
D
T
 
L
T
 
S
R
 
L
C
|
C
I
 
V
G
|
G
C
|
C
R
 
A
K
 
A
C
|
C
E
 
A
Q
 
V
A
 
A
C
|
C
N
 
K
E
 
M
V
 
E
N
|
N
K
 
E
L
 
V
P
 
P
A
 
P
P
 
-
K
 
-
A
 
-
K
 
G
F
 
V
D
 
F
D
 
N
L
|
L
T
 
W
V
x
I
L
 
R
E
 
E
K
 
R
T
 
E
R
 
-
R
 
-
T
 
-
D
 
-
A
 
-
D
 
-
S
 
-
W
 
-
T
 
-
V
 
-
V
 
V
N
 
G
R
 
E
Y
 
Y
N
 
P
A
 
N
A
 
L
G
 
V
L
 
V
D
 
E
H
 
-
P
 
-
V
 
-
F
 
F
R
 
R
K
x
P
Q
 
E
Q
|
Q
C
|
C
N
x
L
H
|
H
C
|
C
L
 
E
E
 
N
P
 
P
A
x
P
C
|
C
A
 
V
S
 
P
A
 
V
C
|
C
F
x
P
V
 
T
K
 
G
A
 
A
F
 
S
T
 
Y
K
 
Q
N
 
T
P
 
K
D
 
D
G
 
G
S
 
L
V
|
V
T
 
L
Y
 
V
D
 
D
G
 
P
S
 
K
L
 
K
C
|
C
V
x
I
G
x
A
C
|
C
R
x
G
Y
 
A
C
|
C
M
 
I
V
 
A
A
 
A
C
|
C
P
|
P
F
x
Y
N
 
D
V
 
A
P
x
R
A
 
Y
F
 
L
Q
 
H
Y
 
P
A
 
A
E
 
G
A
 
-
F
 
-
D
 
-
P
 
-
L
 
Y
I
x
V
Q
 
S
K
 
K
C
|
C
T
 
T
M
x
F
C
|
C
H
 
A
P
 
H
R
 
R
L
 
L
A
 
E
E
 
K
G
 
G
K
 
K
L
 
V
P
|
P
G
x
A
C
|
C
V
 
V
E
 
E
I
 
T
C
|
C
P
 
P
K
 
T
E
 
Y
A
x
C
L
x
R
T
 
T
F
 
F
G
 
G
R
 
D
R
 
L
K
 
E
D
 
D

Sites not aligning to the query:

6f0kB Alternative complex iii (see paper)
28% identity, 50% coverage: 36:219/370 of query aligns to 720:933/961 of 6f0kB

query
sites
6f0kB
Y
 
Y
K
 
R
D
 
N
S
 
Q
Y
 
W
G
 
A
V
 
M
L
 
V
H
 
I
D
 
D
T
 
L
T
 
N
R
 
A
C
|
C
I
x
T
G
|
G
C
|
C
R
x
N
K
x
A
C
|
C
E
 
I
Q
 
V
A
 
A
C
|
C
N
 
D
E
 
S
V
 
E
N
 
N
K
 
N
L
 
I
P
 
P
A
 
-
P
 
-
K
 
-
A
 
-
K
 
-
F
 
-
D
 
-
D
 
-
L
 
M
T
 
V
V
 
G
L
 
K
E
 
N
K
 
E
T
 
V
R
 
G
R
 
R
T
 
G
D
 
R
A
 
E
D
 
M
S
 
H
W
|
W
T
 
L
V
 
R
V
x
I
N
 
D
R
 
R
Y
 
Y
-
 
F
-
 
V
-
 
S
N
 
D
A
 
E
A
 
A
G
 
H
L
 
A
D
 
D
H
 
D
P
 
P
-
 
Q
-
 
I
V
 
V
F
 
V
R
 
Q
K
 
P
Q
 
V
Q
 
P
C
|
C
N
x
M
H
|
H
C
|
C
L
 
E
E
 
N
P
 
A
A
x
P
C
|
C
A
 
E
S
 
S
A
 
V
C
|
C
F
 
P
V
|
V
K
 
A
A
 
A
F
 
T
T
 
V
K
 
H
N
 
S
P
 
P
D
 
D
G
 
G
S
 
L
V
x
N
T
 
E
Y
x
M
D
 
V
G
 
Y
S
x
N
L
x
R
C
|
C
V
x
I
G
|
G
C
 
T
R
 
R
Y
 
Y
C
|
C
M
 
S
V
 
N
A
 
N
C
|
C
P
 
P
F
 
Y
N
 
K
V
 
V
P
 
R
A
 
R
F
 
F
Q
 
N
Y
 
W
A
 
F
E
 
N
-
 
W
-
 
V
-
 
K
-
 
T
-
 
L
-
 
P
-
 
I
-
 
Q
-
 
V
-
 
Q
-
 
M
-
 
A
-
 
Q
-
 
N
-
 
P
-
 
D
-
 
V
-
 
T
-
 
V
A
 
R
F
 
F
D
 
R
P
 
G
L
 
V
I
x
M
Q
 
E
K
 
K
C
|
C
T
 
T
M
x
Y
C
|
C
H
 
V
P
 
Q
R
 
R
L
 
I
A
 
R
E
 
E
G
 
A
-
 
Q
-
x
R
-
 
Q
-
 
A
-
x
N
-
 
I
-
 
E
K
 
K
L
 
R
P
 
P
-
 
L
-
 
R
-
 
D
-
 
G
-
 
E
-
 
V
-
 
K
-
 
T
G
x
A
C
|
C
V
 
Q
E
 
Q
I
 
A
C
|
C
P
 
P
K
 
A
E
 
E
A
 
A
L
 
I
T
 
T
F
 
F
G
 
G
R
 
D
R
 
L
K
 
N
D
 
D
L
 
-
V
 
P
R
 
N
I
 
N
A
 
A
H
 
V
D
 
V
R
 
K
I
 
Q
R
 
R
Q
 
Q
N
 
N
P
 
A
G
 
R
R
 
R
Y
 
Y

Sites not aligning to the query:

8cm6D W-formate dehydrogenase c872a from desulfovibrio vulgaris - with formamide (see paper)
28% identity, 52% coverage: 45:236/370 of query aligns to 7:201/214 of 8cm6D

query
sites
8cm6D
D
 
D
T
 
L
T
 
S
R
 
R
C
|
C
I
x
T
G
x
A
C
|
C
R
|
R
K
 
G
C
|
C
E
 
Q
Q
 
I
A
 
A
C
|
C
N
 
K
E
 
Q
V
 
W
N
x
K
K
 
N
L
 
L
P
 
P
A
 
A
P
 
E
K
 
E
A
 
T
K
 
R
F
 
N
D
 
T
-
 
G
-
 
S
-
 
H
-
 
Q
-
 
N
-
 
P
-
 
P
D
 
D
L
 
L
T
 
S
-
 
Y
V
 
V
L
 
T
E
 
L
K
|
K
T
 
T
R
 
V
R
 
R
T
 
F
D
 
T
A
 
E
D
 
K
S
 
S
W
 
-
T
 
-
V
 
-
V
 
-
N
 
-
R
 
-
Y
x
R
N
 
K
A
 
G
A
x
P
G
 
G
L
 
I
D
 
D
H
 
W
P
 
-
V
 
L
F
 
F
R
 
F
K
 
P
Q
 
E
Q
 
Q
C
|
C
N
x
R
H
 
H
C
|
C
L
 
V
E
 
E
P
|
P
A
x
P
C
|
C
A
 
K
S
 
G
A
 
Q
C
 
A
F
 
D
V
 
V
K
 
D
-
 
L
-
 
E
-
 
G
A
 
A
F
 
V
T
 
V
K
 
K
N
 
D
-
 
E
P
 
T
D
 
T
G
 
G
S
 
A
V
|
V
T
 
L
Y
 
F
-
 
T
D
 
E
G
 
L
S
 
T
L
 
A
C
 
K
V
 
V
G
 
D
C
 
G
R
 
E
Y
 
S
C
 
V
M
 
R
V
 
S
A
 
A
C
|
C
P
 
P
F
 
Y
N
 
D
V
x
I
P
|
P
A
 
R
F
 
I
Q
 
-
Y
 
-
A
 
-
E
 
-
A
 
-
F
 
-
D
 
D
P
 
P
L
 
V
-
 
T
-
 
K
-
 
R
I
 
L
Q
 
S
K
|
K
C
|
C
T
x
D
M
|
M
C
|
C
H
 
N
P
 
D
R
 
R
L
 
V
A
 
Q
E
 
N
G
 
G
K
 
L
L
 
L
P
 
P
G
 
A
C
|
C
V
 
V
E
 
K
I
 
T
C
|
C
P
|
P
K
x
T
E
 
G
A
x
T
L
x
M
T
 
N
F
 
F
G
 
G
R
 
D
R
 
E
K
 
Q
D
 
E
L
 
M
V
 
L
R
 
A
I
 
L
A
 
A
H
 
E
D
 
K
R
 
R
I
 
L
R
 
A
Q
 
E
N
 
V
P
 
K
G
 
K
R
 
T
Y
 
Y
I
 
P
D
 
G
H
 
A
V
 
V
Y
 
L
G
 
G
E
 
D
Q
 
P
E
 
N
M
 
D
G
 
V
G
 
R
T
 
V
A
 
V
W
 
Y
M
 
L
Y
 
F

Sites not aligning to the query:

8bqgB W-formate dehydrogenase from desulfovibrio vulgaris - soaking with formate 1 min (see paper)
28% identity, 52% coverage: 45:236/370 of query aligns to 7:201/214 of 8bqgB

query
sites
8bqgB
D
 
D
T
 
L
T
 
S
R
 
R
C
|
C
I
x
T
G
x
A
C
|
C
R
|
R
K
 
G
C
|
C
E
 
Q
Q
 
I
A
 
A
C
|
C
N
 
K
E
 
Q
V
 
W
N
x
K
K
 
N
L
 
L
P
 
P
A
 
A
P
 
E
K
 
E
A
 
T
K
 
R
F
 
N
D
 
T
-
 
G
-
 
S
-
 
H
-
 
Q
-
 
N
-
 
P
-
 
P
D
 
D
L
 
L
T
 
S
-
 
Y
V
 
V
L
 
T
E
 
L
K
|
K
T
 
T
R
 
V
R
 
R
T
 
F
D
 
T
A
 
E
D
 
K
S
 
S
W
 
-
T
 
-
V
 
-
V
 
-
N
 
-
R
 
-
Y
 
R
N
 
K
A
 
G
A
 
P
G
 
G
L
 
I
D
 
D
H
 
W
P
 
-
V
 
L
F
 
F
R
 
F
K
 
P
Q
 
E
Q
 
Q
C
|
C
N
x
R
H
 
H
C
|
C
L
 
V
E
 
E
P
 
P
A
x
P
C
|
C
A
 
K
S
 
G
A
 
Q
C
 
A
F
 
D
V
 
V
K
 
D
-
 
L
-
 
E
-
 
G
A
 
A
F
 
V
T
 
V
K
 
K
N
 
D
-
 
E
P
 
T
D
 
T
G
 
G
S
 
A
V
|
V
T
 
L
Y
 
F
-
 
T
D
 
E
G
 
L
S
 
T
L
 
A
C
 
K
V
 
V
G
 
D
C
 
G
R
 
E
Y
 
S
C
 
V
M
 
R
V
 
S
A
 
A
C
|
C
P
 
P
F
 
Y
N
 
D
V
x
I
P
|
P
A
 
R
F
 
I
Q
 
-
Y
 
-
A
 
-
E
 
-
A
 
-
F
 
-
D
 
D
P
 
P
L
 
V
-
 
T
-
 
K
-
 
R
I
 
L
Q
 
S
K
|
K
C
|
C
T
 
D
M
|
M
C
|
C
H
 
N
P
 
D
R
 
R
L
 
V
A
 
Q
E
 
N
G
 
G
K
 
L
L
 
L
P
 
P
G
 
A
C
|
C
V
 
V
E
 
K
I
 
T
C
|
C
P
|
P
K
x
T
E
 
G
A
x
T
L
x
M
T
 
N
F
 
F
G
 
G
R
 
D
R
 
E
K
 
Q
D
 
E
L
 
M
V
 
L
R
 
A
I
 
L
A
 
A
H
 
E
D
 
K
R
 
R
I
 
L
R
 
A
Q
 
E
N
 
V
P
 
K
G
 
K
R
 
T
Y
 
Y
I
 
P
D
 
G
H
 
A
V
 
V
Y
 
L
G
 
G
E
 
D
Q
 
P
E
 
N
M
 
D
G
 
V
G
 
R
T
 
V
A
 
V
W
 
Y
M
 
L
Y
 
F

Sites not aligning to the query:

2ivfB Ethylbenzene dehydrogenase from aromatoleum aromaticum (see paper)
34% identity, 30% coverage: 104:214/370 of query aligns to 130:238/337 of 2ivfB

query
sites
2ivfB
V
 
F
F
 
Y
R
 
L
K
 
A
Q
 
R
Q
x
M
C
|
C
N
|
N
H
|
H
C
|
C
L
 
T
E
 
N
P
|
P
A
 
A
C
|
C
A
 
L
S
 
A
A
 
A
C
|
C
F
 
P
V
x
T
K
 
G
A
 
A
F
x
I
T
 
Y
K
 
K
N
 
R
P
 
E
D
 
D
-
 
N
G
 
G
S
 
I
V
|
V
T
 
L
Y
 
V
D
 
D
G
 
Q
S
 
E
L
 
R
C
|
C
V
x
K
G
|
G
C
x
H
R
|
R
Y
x
H
C
|
C
M
 
V
V
 
E
A
 
A
C
|
C
P
 
P
F
 
Y
N
 
K
V
 
-
P
 
-
A
 
-
F
 
-
Q
 
-
Y
 
-
A
|
A
E
x
I
A
 
Y
F
 
F
D
 
N
P
 
P
L
 
V
I
 
S
Q
 
Q
-
 
T
-
x
S
-
 
E
K
|
K
C
|
C
T
x
I
M
x
L
C
|
C
H
 
Y
P
 
P
R
 
R
L
 
I
A
 
E
E
 
K
G
 
G
K
 
I
L
 
A
P
x
N
G
 
A
C
|
C
V
 
N
E
 
R
I
 
Q
C
|
C
P
 
P
K
 
G
E
 
R
A
x
V
L
x
R
T
 
A
F
 
F
G
 
G
R
 
Y
R
 
L
K
 
D
D
 
D
L
 
T
V
 
T
R
 
S
I
 
H
A
 
V
H
 
H
D
 
K
R
 
L
I
 
V
R
 
K
Q
 
K

Sites not aligning to the query:

5ch7B Crystal structure of the perchlorate reductase pcrab - phe164 gate switch intermediate - from azospira suillum ps (see paper)
32% identity, 30% coverage: 105:214/370 of query aligns to 128:235/329 of 5ch7B

query
sites
5ch7B
F
 
Y
R
 
L
K
x
P
Q
 
R
Q
 
M
C
|
C
N
|
N
H
 
H
C
|
C
L
 
T
E
 
K
P
|
P
A
 
A
C
|
C
A
 
L
S
 
E
A
 
A
C
|
C
F
 
P
V
 
N
K
 
E
A
 
A
-
x
I
F
 
Y
T
 
K
K
 
R
N
 
E
P
 
Q
D
 
D
G
 
G
S
 
I
V
 
V
T
 
V
Y
 
I
D
 
H
G
 
Q
S
 
D
L
 
K
C
|
C
V
x
K
G
|
G
C
x
A
R
x
Q
Y
x
A
C
|
C
M
 
V
V
 
Q
A
 
S
C
|
C
P
 
P
F
 
Y
N
 
A
V
 
K
P
 
P
A
 
Y
F
 
F
Q
 
-
Y
 
-
A
 
-
E
 
-
A
 
-
F
 
-
D
 
N
P
 
P
L
 
L
I
 
T
Q
 
N
K
 
K
-
x
A
-
 
N
-
 
K
C
|
C
T
 
I
M
x
G
C
|
C
H
 
F
P
 
P
R
 
R
L
 
I
A
 
E
E
 
Q
G
 
G
K
 
V
L
 
A
P
 
P
G
 
A
C
|
C
V
 
V
E
 
A
I
 
Q
C
|
C
P
x
V
K
x
G
E
 
R
A
 
A
L
 
M
T
 
H
F
 
V
G
 
G
R
 
F
R
 
V
K
 
D
D
 
D
L
 
V
V
 
N
R
 
S
I
 
S
A
 
V
H
 
Y
D
 
K
R
 
L
I
 
I
R
 
K
Q
 
Q

Sites not aligning to the query:

7qv7B Cryo-em structure of hydrogen-dependent co2 reductase. (see paper)
31% identity, 42% coverage: 42:198/370 of query aligns to 7:161/183 of 7qv7B

query
sites
7qv7B
V
 
V
L
 
V
H
 
A
D
 
N
T
 
P
T
 
A
R
 
K
C
|
C
I
 
I
G
|
G
C
|
C
R
x
K
K
x
A
C
|
C
E
 
E
Q
 
V
A
 
A
C
|
C
N
 
F
E
 
A
V
 
V
N
x
H
K
 
N
L
 
-
P
 
-
A
 
-
P
 
-
K
 
R
A
 
N
K
 
N
F
 
H
D
 
V
D
 
G
L
 
A
T
 
T
V
 
V
L
 
-
E
 
-
K
 
-
T
 
-
R
 
-
R
 
-
T
 
-
D
 
G
A
 
T
D
 
V
S
 
S
W
 
I
T
 
P
V
 
V
V
 
I
N
 
P
R
|
R
Y
 
L
N
 
H
A
 
L
A
 
I
G
 
K
L
 
T
D
 
E
H
 
H
P
 
G
V
 
T
F
 
M
R
 
-
K
 
P
Q
 
I
Q
 
Q
C
|
C
N
x
R
H
|
H
C
|
C
L
 
E
E
 
D
P
x
A
A
 
P
C
|
C
A
 
A
S
 
N
A
 
V
C
|
C
F
 
T
V
 
V
K
 
G
A
|
A
F
x
I
T
 
-
K
 
K
N
 
R
P
 
E
D
 
G
G
 
N
S
 
A
V
 
I
T
 
V
Y
 
V
D
 
D
G
 
E
S
 
K
L
 
L
C
|
C
V
x
I
G
 
G
C
|
C
R
 
K
Y
 
S
C
|
C
M
 
L
V
 
L
A
 
A
C
|
C
P
 
P
F
 
F
N
 
G
-
 
A
-
x
I
-
 
E
-
 
L
V
 
L
P
 
P
A
 
Q
F
 
Y
Q
 
E
Y
 
D
A
 
G
-
 
R
E
 
E
A
 
V
F
 
F
D
 
Q
-
 
I
-
 
N
-
 
L
P
 
K
L
 
L
I
 
V
Q
 
Q
-
 
E
-
 
P
-
 
R
-
 
I
-
 
I
-
 
A
-
 
Y
K
 
K
C
|
C
T
 
D
M
x
L
C
|
C
H
 
N
P
 
-
R
 
D
L
 
L
A
 
G
E
 
E
G
 
-
K
 
-
L
 
-
P
|
P
G
 
A
C
|
C
V
 
V
E
 
K
I
 
A
C
|
C
P
|
P
K
 
E
E
 
N
A
 
A
L
|
L
T
 
T
F
 
L

Q8GC87 Formate dehydrogenase subunit beta; FDH subunit beta; Formate dehydrogenase small subunit from Megalodesulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759) (Desulfovibrio gigas) (see paper)
27% identity, 49% coverage: 39:221/370 of query aligns to 2:187/215 of Q8GC87

query
sites
Q8GC87
S
 
S
Y
 
K
G
 
G
V
 
F
L
 
F
H
 
V
D
 
D
T
 
T
T
 
T
R
 
R
C
|
C
I
 
T
G
 
A
C
|
C
R
 
R
K
 
G
C
|
C
E
 
Q
Q
 
V
A
 
A
C
|
C
N
 
K
E
 
Q
V
 
W
N
 
H
K
 
G
L
 
N
P
 
P
A
 
A
P
 
T
K
 
P
A
 
T
K
 
-
F
 
-
D
 
E
D
 
N
L
 
T
T
 
G
V
 
F
L
 
H
E
 
Q
K
 
N
T
 
P
R
 
P
R
 
D
T
 
F
D
 
N
A
 
F
D
 
H
S
 
T
W
 
Y
T
 
K
V
 
L
V
 
V
N
 
R
R
 
M
Y
 
H
N
 
E
A
 
Q
A
 
E
-
 
I
-
 
D
G
 
G
L
 
R
D
 
I
H
 
D
P
 
W
V
 
L
F
 
F
R
 
F
K
 
P
Q
 
D
Q
 
Q
C
|
C
N
 
R
H
 
H
C
|
C
L
 
I
E
 
A
P
 
P
A
 
P
C
|
C
A
 
K
S
 
A
A
 
T
C
 
-
F
 
-
V
 
-
K
 
-
A
 
A
F
 
D
T
 
M
K
 
E
N
 
D
P
 
E
D
 
S
G
 
A
S
 
I
V
 
I
T
 
H
Y
 
D
D
 
D
G
 
A
S
 
T
L
 
G
C
 
C
V
 
V
-
 
L
-
 
F
-
 
T
-
 
P
-
 
K
-
 
T
-
 
K
-
 
D
-
 
L
-
 
E
G
 
D
C
 
Y
R
 
E
Y
 
S
C
 
V
M
 
I
V
 
S
A
 
A
C
|
C
P
 
P
F
 
Y
N
 
D
V
 
V
P
 
P
A
 
R
F
 
-
Q
 
K
Y
 
V
A
 
A
E
 
E
A
 
S
F
 
N
D
 
Q
P
 
-
L
 
-
I
 
M
Q
 
A
K
 
K
C
|
C
T
 
D
M
 
M
C
|
C
H
 
I
P
 
D
R
 
R
L
 
I
A
 
T
E
 
N
G
 
G
K
 
L
L
 
R
P
 
P
G
 
A
C
|
C
V
 
V
E
 
T
I
 
S
C
|
C
P
 
P
K
 
T
E
 
G
A
 
A
L
 
M
T
 
N
F
 
F
G
 
G
R
 
D
R
 
L
K
 
S
D
 
E
L
 
M
V
 
E
R
 
A
I
 
M
A
 
A
H
 
S
D
 
A
R
 
R
I
 
L
R
 
A
Q
 
E
N
 
I
P
 
K
G
 
A
R
 
A
Y
 
Y
I
 
S
D
 
D

1h0hB Tungsten containing formate dehydrogenase from desulfovibrio gigas (see paper)
27% identity, 49% coverage: 39:221/370 of query aligns to 1:186/214 of 1h0hB

query
sites
1h0hB
S
 
S
Y
 
K
G
 
G
V
x
F
L
 
F
H
 
V
D
 
D
T
 
T
T
 
T
R
 
R
C
|
C
I
x
T
G
x
A
C
|
C
R
|
R
K
 
G
C
|
C
E
 
Q
Q
 
V
A
 
A
C
|
C
N
 
K
E
 
Q
V
 
W
N
x
H
K
 
G
L
 
N
P
 
P
A
 
A
P
 
T
K
 
P
A
 
T
K
 
-
F
 
-
D
 
E
D
 
N
L
 
T
T
 
G
V
 
F
L
 
H
E
 
Q
K
 
N
T
 
P
R
 
P
R
 
D
T
 
F
D
 
N
A
 
F
D
 
H
S
 
T
W
 
Y
T
x
K
V
 
L
V
 
V
N
 
R
R
 
M
Y
 
H
N
 
E
A
 
Q
A
 
E
-
 
I
-
 
D
G
 
G
L
 
R
D
 
I
H
 
D
P
 
W
V
 
L
F
 
F
R
 
F
K
 
P
Q
 
D
Q
|
Q
C
|
C
N
x
R
H
 
H
C
|
C
L
 
I
E
 
A
P
 
P
A
x
P
C
|
C
A
 
K
S
 
A
A
 
T
C
 
-
F
 
-
V
 
-
K
 
-
A
 
A
F
 
D
T
 
M
K
 
E
N
 
D
P
 
E
D
 
S
G
 
A
S
 
I
V
 
I
T
 
H
Y
 
D
D
 
D
G
 
A
S
 
T
L
 
G
C
 
C
V
|
V
-
 
L
-
 
F
-
 
T
-
 
P
-
 
K
-
 
T
-
 
K
-
 
D
-
 
L
-
 
E
G
 
D
C
 
Y
R
 
E
Y
 
S
C
 
V
M
 
I
V
 
S
A
 
A
C
|
C
P
 
P
F
 
Y
N
 
D
V
 
V
P
|
P
A
 
R
F
 
-
Q
 
K
Y
 
V
A
 
A
E
 
E
A
 
S
F
 
N
D
 
Q
P
 
-
L
 
-
I
 
M
Q
 
A
K
|
K
C
|
C
T
x
D
M
|
M
C
|
C
H
 
I
P
 
D
R
 
R
L
 
I
A
 
T
E
 
N
G
 
G
K
 
L
L
 
R
P
 
P
G
 
A
C
|
C
V
 
V
E
 
T
I
 
S
C
|
C
P
|
P
K
 
T
E
 
G
A
|
A
L
 
M
T
 
N
F
 
F
G
 
G
R
 
D
R
 
L
K
 
S
D
 
E
L
 
M
V
 
E
R
 
A
I
 
M
A
 
A
H
 
S
D
 
A
R
 
R
I
 
L
R
 
A
Q
 
E
N
 
I
P
 
K
G
 
A
R
 
A
Y
 
Y
I
 
S
D
 
D

7z0sB Structure of the escherichia coli formate hydrogenlyase complex (anaerobic preparation, without formate dehydrogenase h) (see paper)
33% identity, 34% coverage: 42:166/370 of query aligns to 5:106/170 of 7z0sB

query
sites
7z0sB
V
 
V
L
 
I
H
 
A
D
 
D
T
 
S
T
 
T
R
 
L
C
|
C
I
|
I
G
|
G
C
|
C
R
x
H
K
x
T
C
|
C
E
 
E
Q
 
A
A
 
A
C
|
C
N
 
S
E
 
E
V
 
T
N
x
H
K
 
R
L
 
Q
P
 
-
A
 
-
P
 
-
K
 
-
A
 
-
K
 
-
F
 
-
D
 
H
D
 
G
L
 
L
T
 
Q
V
 
S
L
 
M
E
 
P
K
x
R
T
x
L
R
 
R
R
 
-
T
 
-
D
 
-
A
 
-
D
 
-
S
 
-
W
 
-
T
 
V
V
 
M
V
 
L
N
 
N
R
 
E
Y
 
K
N
 
E
A
 
S
A
 
A
G
 
-
L
 
-
D
 
-
H
 
-
P
 
-
V
 
-
F
 
-
R
 
-
K
x
P
Q
 
Q
Q
x
L
C
|
C
N
x
H
H
|
H
C
|
C
L
 
E
E
 
D
P
 
A
A
 
P
C
|
C
A
 
A
S
 
V
A
 
V
C
|
C
F
x
P
V
 
V
K
 
N
A
 
A
F
x
I
T
 
T
K
 
R
N
 
-
P
 
V
D
 
D
G
 
G
S
 
A
V
|
V
T
 
Q
Y
x
L
D
 
N
G
 
E
S
 
S
L
 
L
C
|
C
V
|
V
G
 
S
C
|
C
R
x
K
Y
 
L
C
|
C
M
 
G
V
 
I
A
 
A
C
|
C
P
 
P
F
 
F
N
 
G
V
 
A
P
x
I
A
 
E
F
 
F
Q
 
S
Y
 
G
A
 
S
E
 
R
A
 
P
F
 
L
D
 
D

Sites not aligning to the query:

8k9fB Cryo-em structure of the photosynthetic alternative complex iii from chloroflexus aurantiacus at 2.9 angstrom (see paper)
23% identity, 45% coverage: 37:203/370 of query aligns to 707:909/951 of 8k9fB

query
sites
8k9fB
K
 
R
D
 
N
S
 
A
Y
 
W
G
 
G
V
 
M
L
 
T
H
 
I
D
 
N
T
 
L
T
 
N
R
 
A
C
|
C
I
 
I
G
|
G
C
|
C
R
x
N
K
 
A
C
|
C
E
 
V
Q
 
V
A
 
A
C
|
C
N
 
Q
E
 
A
V
 
E
N
|
N
K
 
N
L
 
I
P
 
A
A
 
-
P
 
-
K
 
-
A
 
-
K
 
-
F
 
-
D
 
-
D
 
-
L
 
V
T
 
V
V
 
G
L
 
K
E
 
D
K
 
Q
T
 
V
R
 
S
R
 
R
T
 
G
D
 
R
A
 
E
D
 
M
S
 
H
W
|
W
T
x
I
V
 
R
V
 
I
N
 
D
R
 
R
Y
 
Y
N
 
F
A
 
A
A
 
G
-
 
E
G
 
D
L
 
L
D
 
D
H
 
N
P
 
P
V
 
S
F
 
I
R
 
Y
K
 
M
Q
 
M
-
x
P
-
 
V
Q
 
N
C
|
C
N
x
M
H
x
Q
C
|
C
L
 
E
E
 
K
P
 
A
A
 
P
C
|
C
A
 
E
S
 
V
A
 
V
C
|
C
F
x
P
V
 
V
K
 
A
A
 
A
F
 
T
T
 
V
K
 
H
N
 
D
P
 
Y
D
 
E
G
 
G
S
 
L
V
x
N
T
 
N
Y
x
M
D
 
V
G
 
Y
S
x
N
L
x
R
C
|
C
V
 
V
G
|
G
C
x
T
R
x
K
Y
|
Y
C
|
C
M
 
S
V
 
N
A
 
N
C
|
C
P
 
P
F
x
Y
N
 
K
V
|
V
P
 
R
A
 
R
F
 
F
Q
 
N
Y
 
F
A
 
L
E
 
Q
-
 
Y
-
 
S
-
 
D
-
 
T
-
 
T
-
 
T
-
 
E
-
 
T
-
 
F
-
 
K
-
 
L
A
 
A
F
 
F
D
 
N
P
 
P
-
 
D
-
 
V
-
 
T
-
 
V
-
 
R
-
 
I
-
 
R
-
 
G
L
 
V
I
 
M
Q
 
E
K
 
K
C
|
C
T
 
T
M
x
Y
C
|
C
H
 
V
P
 
Q
R
 
R
L
 
I
A
 
S
E
 
G
G
 
A
K
x
R
L
 
I
-
 
A
-
 
A
-
x
K
-
 
R
-
 
A
-
 
A
-
 
V
-
 
Q
-
 
A
-
 
G
-
 
Q
-
 
S
-
 
S
-
 
Y
-
 
V
-
 
I
-
 
S
-
 
D
-
 
G
-
 
A
-
 
I
-
 
Q
P
x
T
G
 
A
C
|
C
V
 
E
E
 
Q
I
 
A
C
|
C
P
|
P
K
x
T
E
 
G
A
 
A
L
 
I
T
 
V
F
 
F
G
 
G
R
 
D
R
 
I
K
 
N
D
 
D

Sites not aligning to the query:

8k9eB Cryo-em structure of the photosynthetic alternative complex iii from chloroflexus aurantiacus at 3.3 angstrom (see paper)
23% identity, 45% coverage: 37:203/370 of query aligns to 707:909/951 of 8k9eB

query
sites
8k9eB
K
 
R
D
 
N
S
 
A
Y
 
W
G
 
G
V
 
M
L
 
T
H
 
I
D
 
N
T
 
L
T
 
N
R
 
A
C
|
C
I
|
I
G
|
G
C
|
C
R
x
N
K
 
A
C
|
C
E
 
V
Q
 
V
A
 
A
C
|
C
N
 
Q
E
 
A
V
 
E
N
|
N
K
 
N
L
 
I
P
 
A
A
 
-
P
 
-
K
 
-
A
 
-
K
 
-
F
 
-
D
 
-
D
 
-
L
 
V
T
 
V
V
 
G
L
 
K
E
 
D
K
 
Q
T
 
V
R
 
S
R
 
R
T
 
G
D
 
R
A
 
E
D
 
M
S
 
H
W
 
W
T
 
I
V
 
R
V
x
I
N
 
D
R
 
R
Y
 
Y
N
 
F
A
 
A
A
 
G
-
 
E
G
 
D
L
 
L
D
 
D
H
 
N
P
 
P
V
 
S
F
 
I
R
 
Y
K
 
M
Q
 
M
-
 
P
-
 
V
Q
 
N
C
|
C
N
x
M
H
 
Q
C
|
C
L
 
E
E
 
K
P
 
A
A
x
P
C
|
C
A
 
E
S
 
V
A
 
V
C
|
C
F
 
P
V
 
V
K
 
A
A
 
A
F
 
T
T
 
V
K
 
H
N
 
D
P
 
Y
D
 
E
G
 
G
S
 
L
V
x
N
T
 
N
Y
x
M
D
 
V
G
 
Y
S
x
N
L
 
R
C
|
C
V
|
V
G
|
G
C
x
T
R
x
K
Y
|
Y
C
|
C
M
 
S
V
 
N
A
 
N
C
|
C
P
 
P
F
x
Y
N
 
K
V
|
V
P
x
R
A
 
R
F
 
F
Q
 
N
Y
 
F
A
 
L
E
 
Q
-
 
Y
-
 
S
-
 
D
-
 
T
-
 
T
-
 
T
-
 
E
-
 
T
-
 
F
-
 
K
-
 
L
A
 
A
F
 
F
D
 
N
P
 
P
-
 
D
-
 
V
-
 
T
-
 
V
-
 
R
-
 
I
-
 
R
-
 
G
L
 
V
I
x
M
Q
 
E
K
 
K
C
|
C
T
 
T
M
x
Y
C
|
C
H
 
V
P
 
Q
R
 
R
L
 
I
A
 
S
E
 
G
G
 
A
K
x
R
L
 
I
-
 
A
-
 
A
-
x
K
-
 
R
-
 
A
-
 
A
-
 
V
-
 
Q
-
 
A
-
 
G
-
 
Q
-
 
S
-
 
S
-
 
Y
-
 
V
-
 
I
-
 
S
-
 
D
-
 
G
-
 
A
-
 
I
-
 
Q
P
x
T
G
 
A
C
|
C
V
 
E
E
 
Q
I
 
A
C
|
C
P
 
P
K
x
T
E
 
G
A
 
A
L
 
I
T
 
V
F
 
F
G
 
G
R
 
D
R
 
I
K
 
N
D
 
D

Sites not aligning to the query:

3egwB The crystal structure of the narghi mutant narh - c16a
33% identity, 24% coverage: 104:191/370 of query aligns to 178:263/509 of 3egwB

query
sites
3egwB
V
 
M
F
 
Y
R
 
L
K
x
P
Q
 
R
Q
 
L
C
|
C
N
x
E
H
|
H
C
|
C
L
 
L
E
 
N
P
|
P
A
 
A
C
|
C
A
 
V
S
 
A
A
 
T
C
|
C
F
 
P
V
x
S
K
 
G
A
 
A
-
x
I
F
 
Y
T
 
K
K
 
R
N
 
E
P
 
E
D
 
D
G
 
G
S
 
I
V
 
V
T
 
L
Y
 
I
D
 
D
G
 
Q
S
 
D
L
 
K
C
|
C
V
x
R
G
|
G
C
x
W
R
|
R
Y
 
M
C
|
C
M
 
I
V
 
T
A
 
G
C
|
C
P
 
P
F
 
Y
N
 
K
V
 
K
P
x
I
A
 
Y
F
 
F
Q
 
N
Y
 
W
A
 
K
E
 
S
A
 
G
F
 
K
D
x
S
P
 
-
L
 
-
I
 
-
Q
 
E
K
|
K
C
|
C
T
 
I
M
x
F
C
|
C
H
 
Y
P
 
P
R
 
R
L
 
I
A
 
E
E
 
A
G
 
G
K
 
Q
L
 
P
P
x
T
G
 
V
C
|
C
V
 
S
E
 
E
I
 
T
C
|
C

Sites not aligning to the query:

P11349 Respiratory nitrate reductase 1 beta chain; Nitrate reductase A subunit beta; Quinol-nitrate oxidoreductase subunit beta; EC 1.7.5.1 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 24% coverage: 104:191/370 of query aligns to 178:263/512 of P11349

query
sites
P11349
V
 
M
F
 
Y
R
 
L
K
 
P
Q
 
R
Q
 
L
C
|
C
N
 
E
H
 
H
C
|
C
L
 
L
E
 
N
P
 
P
A
 
A
C
|
C
A
 
V
S
 
A
A
 
T
C
|
C
F
 
P
V
 
S
K
 
G
A
 
A
-
 
I
F
 
Y
T
 
K
K
 
R
N
 
E
P
 
E
D
 
D
G
 
G
S
 
I
V
 
V
T
 
L
Y
 
I
D
 
D
G
 
Q
S
 
D
L
 
K
C
|
C
V
 
R
G
 
G
C
 
W
R
 
R
Y
 
M
C
|
C
M
 
I
V
 
T
A
 
G
C
|
C
P
 
P
F
 
Y
N
 
K
V
 
K
P
 
I
A
 
Y
F
 
F
Q
 
N
Y
 
W
A
 
K
E
 
S
A
 
G
F
 
K
D
 
S
P
 
-
L
 
-
I
 
-
Q
 
E
K
 
K
C
|
C
T
 
I
M
 
F
C
|
C
H
 
Y
P
 
P
R
 
R
L
 
I
A
 
E
E
 
A
G
 
G
K
 
Q
L
 
P
P
 
T
G
 
V
C
|
C
V
 
S
E
 
E
I
 
T
C
|
C

Sites not aligning to the query:

6cz7B The arsenate respiratory reductase (arr) complex from shewanella sp. Ana-3 (see paper)
25% identity, 44% coverage: 41:203/370 of query aligns to 4:195/234 of 6cz7B

query
sites
6cz7B
G
 
G
V
 
M
L
 
V
H
 
I
D
 
D
T
 
L
T
 
Q
R
 
K
C
|
C
I
x
V
G
|
G
C
|
C
R
x
G
K
 
G
C
|
C
E
 
S
Q
 
L
A
 
A
C
|
C
N
 
K
E
 
T
V
 
E
N
|
N
K
 
N
L
 
-
P
 
-
A
 
-
P
 
-
K
 
-
A
 
-
K
 
T
F
 
N
D
 
D
D
 
G
L
 
I
T
 
H
V
 
W
L
 
S
E
 
H
K
 
H
T
 
I
R
 
A
R
 
T
T
 
T
D
 
E
A
 
G
D
 
T
S
 
F
W
 
P
T
 
D
V
 
V
V
 
-
N
 
-
R
 
K
Y
 
Y
N
 
-
A
 
-
A
 
-
G
 
-
L
 
-
D
 
-
H
 
-
P
 
-
V
 
T
F
x
Y
R
 
I
K
x
P
Q
 
T
Q
 
L
C
|
C
N
|
N
H
|
H
C
|
C
L
 
D
E
 
D
P
x
A
A
x
P
C
|
C
A
 
V
S
 
K
A
 
V
C
|
C
F
x
P
V
 
T
K
 
G
A
 
A
F
 
M
T
 
H
K
 
K
N
 
D
P
 
K
D
 
R
G
 
G
S
 
L
V
x
T
T
 
L
Y
 
Q
D
 
N
G
 
N
S
 
D
L
 
E
C
|
C
V
x
I
G
|
G
C
|
C
R
x
K
Y
 
K
C
|
C
M
 
M
V
 
N
A
 
A
C
|
C
P
 
P
F
x
Y
N
 
G
V
|
V
P
x
I
A
 
S
F
 
F
Q
 
N
Y
 
A
A
 
A
E
 
T
-
 
P
-
 
H
-
 
R
-
 
R
-
 
W
-
 
Q
-
 
D
-
 
D
-
 
S
-
 
E
-
 
V
-
 
V
-
 
A
-
 
N
-
 
G
A
 
T
F
 
V
D
 
S
P
 
P
L
 
L
I
 
M
-
 
L
-
 
L
-
 
K
-
 
R
-
 
T
-
 
G
-
 
A
-
 
T
-
 
A
-
 
T
-
 
P
-
 
N
-
 
E
-
 
N
-
 
P
-
 
E
-
 
R
-
 
G
-
 
D
-
 
T
-
 
Y
-
 
P
-
 
M
-
 
I
-
 
R
-
 
P
-
 
K
-
 
R
-
 
T
-
x
T
Q
 
E
K
|
K
C
|
C
T
 
T
M
x
F
C
|
C
H
 
D
P
 
H
R
 
R
L
 
L
A
 
D
E
 
K
G
 
G
K
 
L
L
 
N
P
 
P
G
 
A
C
|
C
V
 
V
E
 
D
I
 
A
C
|
C
P
|
P
K
 
S
E
 
E
A
 
A
L
x
R
T
 
V
F
 
I
G
 
G
R
 
D
R
 
L
K
 
D
D
 
D

Q7WTT9 Arsenate respiratory reductase iron-sulfur subunit ArrB; Arsenate respiratory reductase small subunit; ARR small subunit from Shewanella sp. (strain ANA-3) (see paper)
25% identity, 44% coverage: 41:203/370 of query aligns to 4:195/234 of Q7WTT9

query
sites
Q7WTT9
G
 
G
V
 
M
L
 
V
H
 
I
D
 
D
T
 
L
T
 
Q
R
 
K
C
|
C
I
 
V
G
 
G
C
|
C
R
 
G
K
 
G
C
|
C
E
 
S
Q
 
L
A
 
A
C
|
C
N
 
K
E
 
T
V
 
E
N
 
N
K
 
N
L
 
-
P
 
-
A
 
-
P
 
-
K
 
-
A
 
-
K
 
T
F
 
N
D
 
D
D
 
G
L
 
I
T
 
H
V
 
W
L
 
S
E
 
H
K
 
H
T
 
I
R
 
A
R
 
T
T
 
T
D
 
E
A
 
G
D
 
T
S
 
F
W
 
P
T
 
D
V
 
V
V
 
-
N
 
-
R
 
K
Y
 
Y
N
 
-
A
 
-
A
 
-
G
 
-
L
 
-
D
 
-
H
 
-
P
 
-
V
 
T
F
 
Y
R
 
I
K
 
P
Q
 
T
Q
 
L
C
|
C
N
 
N
H
 
H
C
|
C
L
 
D
E
 
D
P
 
A
A
 
P
C
|
C
A
 
V
S
 
K
A
 
V
C
|
C
F
 
P
V
 
T
K
 
G
A
 
A
F
 
M
T
 
H
K
 
K
N
 
D
P
 
K
D
 
R
G
 
G
S
 
L
V
 
T
T
 
L
Y
 
Q
D
 
N
G
 
N
S
 
D
L
 
E
C
|
C
V
 
I
G
 
G
C
|
C
R
 
K
Y
 
K
C
|
C
M
 
M
V
 
N
A
 
A
C
|
C
P
 
P
F
 
Y
N
 
G
V
 
V
P
 
I
A
 
S
F
 
F
Q
 
N
Y
 
A
A
 
A
E
 
T
-
 
P
-
 
H
-
 
R
-
 
R
-
 
W
-
 
Q
-
 
D
-
 
D
-
 
S
-
 
E
-
 
V
-
 
V
-
 
A
-
 
N
-
 
G
A
 
T
F
 
V
D
 
S
P
 
P
L
 
L
I
 
M
-
 
L
-
 
L
-
 
K
-
 
R
-
 
T
-
 
G
-
 
A
-
 
T
-
 
A
-
 
T
-
 
P
-
 
N
-
 
E
-
 
N
-
 
P
-
 
E
-
 
R
-
 
G
-
 
D
-
 
T
-
 
Y
-
 
P
-
 
M
-
 
I
-
 
R
-
 
P
-
 
K
-
 
R
-
 
T
-
 
T
Q
 
E
K
 
K
C
|
C
T
 
T
M
 
F
C
|
C
H
 
D
P
 
H
R
 
R
L
 
L
A
 
D
E
 
K
G
 
G
K
 
L
L
 
N
P
 
P
G
 
A
C
|
C
V
 
V
E
 
D
I
 
A
C
|
C
P
 
P
K
 
S
E
 
E
A
 
A
L
 
R
T
 
V
F
 
I
G
 
G
R
 
D
R
 
L
K
 
D
D
 
D

Query Sequence

>209474 MicrobesOnline__882:209474
MDRRRFLTLLGSAGLTATVATAGTAKAASTGTFPGYKDSYGVLHDTTRCIGCRKCEQACN
EVNKLPAPKAKFDDLTVLEKTRRTDADSWTVVNRYNAAGLDHPVFRKQQCNHCLEPACAS
ACFVKAFTKNPDGSVTYDGSLCVGCRYCMVACPFNVPAFQYAEAFDPLIQKCTMCHPRLA
EGKLPGCVEICPKEALTFGRRKDLVRIAHDRIRQNPGRYIDHVYGEQEMGGTAWMYLSGV
PFSATGMNEELGTKSAPEYTAGALGAVPMVVGIWPILLTGAYAITKRKEKIAAEEQAEAV
KQAVAASRAEADDKLKAALAKADKDKEAAVTREVKKAVDEARKTFEEELAAKEQPEAPEG
DDAGKPGEDA

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory