Comparing 209573 MicrobesOnline__882:209573 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
3uf6A The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with cod (3'-dephosphocoenzyme a)
40% identity, 65% coverage: 110:333/343 of query aligns to 69:279/285 of 3uf6A
3u9eB The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa.
40% identity, 65% coverage: 110:333/343 of query aligns to 71:281/288 of 3u9eB
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
28% identity, 85% coverage: 50:340/343 of query aligns to 405:711/714 of Q8ZND6
Sites not aligning to the query:
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
34% identity, 59% coverage: 118:321/343 of query aligns to 118:317/339 of 6ioxA
6zngF Maeb full-length acetyl-coa bound state (see paper)
31% identity, 40% coverage: 174:310/343 of query aligns to 582:715/753 of 6zngF
Sites not aligning to the query:
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
27% identity, 85% coverage: 29:321/343 of query aligns to 19:311/333 of P38503
Sites not aligning to the query:
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
27% identity, 85% coverage: 29:321/343 of query aligns to 18:310/332 of 2af3C
>209573 MicrobesOnline__882:209573
MSVLQAGTATETPRTSDAGRQNEGADGAVAAPRTLDDIVAAVVRRGIPVRVAVAACAEPN
ALAAVLEARDMGMAVPVLVGDIAATESIATERGLSLEGCEVEDEPVPVKAVQRAVDRVRT
GGADVLMKGLVNTDVLLRVVLNRVSGLSAGGLLSHVAVCSLPATCGGEASASSRLVCITD
AAVNISPNMERKLGIVRNAICVARSLGIPSPRVAMLAATEKVMLPAMPATLDAQIVARMA
DQGEFGDAMVAGPMALDVAISPDIAARKGVSHPVAGRADILCAPDIESGNILYKSLTTLA
HVEMAGILTGTTAPVVVPSRGDSRRSKLLSLALAAYVAMECRL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory