Comparing 209701 MicrobesOnline__882:209701 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
40% identity, 98% coverage: 6:228/228 of query aligns to 1:227/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
39% identity, 98% coverage: 6:228/228 of query aligns to 1:227/230 of 1l2tA
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
40% identity, 96% coverage: 5:224/228 of query aligns to 2:220/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
40% identity, 96% coverage: 5:224/228 of query aligns to 2:220/592 of 5lj7A
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
42% identity, 97% coverage: 4:224/228 of query aligns to 2:221/650 of 5ws4A
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
37% identity, 97% coverage: 4:224/228 of query aligns to 1:220/226 of 5xu1B
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
41% identity, 96% coverage: 6:224/228 of query aligns to 4:221/648 of P75831
8g4cB Bceabs atpgs high res tm (see paper)
35% identity, 96% coverage: 6:224/228 of query aligns to 3:221/248 of 8g4cB
7tchB Bceab e169q variant atp-bound conformation (see paper)
35% identity, 96% coverage: 6:224/228 of query aligns to 2:220/245 of 7tchB
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
39% identity, 87% coverage: 26:224/228 of query aligns to 19:216/223 of 2pclA
P9WQK5 Uncharacterized ABC transporter ATP-binding protein Rv0073 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
46% identity, 86% coverage: 24:219/228 of query aligns to 18:215/330 of P9WQK5
7w78A Heme exporter hrtba in complex with mg-amppnp (see paper)
41% identity, 99% coverage: 3:227/228 of query aligns to 1:218/218 of 7w78A
7w79A Heme exporter hrtba in complex with mn-amppnp (see paper)
41% identity, 97% coverage: 3:223/228 of query aligns to 1:214/216 of 7w79A
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
38% identity, 97% coverage: 4:224/228 of query aligns to 3:223/233 of P75957
7mdyC Lolcde nucleotide-bound
38% identity, 96% coverage: 6:224/228 of query aligns to 2:220/226 of 7mdyC
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 98% coverage: 6:228/228 of query aligns to 1:223/343 of P30750
Sites not aligning to the query:
7arlD Lolcde in complex with lipoprotein and adp (see paper)
38% identity, 96% coverage: 6:224/228 of query aligns to 2:220/222 of 7arlD
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
37% identity, 97% coverage: 4:224/228 of query aligns to 2:222/229 of 7v8iD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
37% identity, 98% coverage: 6:228/228 of query aligns to 2:224/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
37% identity, 98% coverage: 6:228/228 of query aligns to 2:224/344 of 3tuiC
>209701 MicrobesOnline__882:209701
MEARTLLEVHGVSMVFGAGENAQYALRDVHLSVRDGEVLMLRGPSGSGKTTLLSIMGGIL
SPTEGTLTVDGTPMTGLSAEARSALRLKHFGFIFQDYNLFPTLTCSQNIQVALDLRGVPR
DEARRIADATLGEVGLGGKVGEMPARLSGGQKQRLAVARALAGSPMVMLADEPTAALDST
NGLMIMSLLRDLAHAGGRAVVVVTHDDRIMPFADRVVHIEDGRIKETE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory