Comparing 2629599894 IMG__TrieryIMS101_FD:2629599894 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
Q58667 Methanogen homoaconitase small subunit; HACN; Homoaconitate hydratase; EC 4.2.1.114 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
36% identity, 97% coverage: 5:182/183 of query aligns to 3:166/170 of Q58667
2pkpA Crystal structure of 3-isopropylmalate dehydratase (leud)from methhanocaldococcus jannaschii dsm2661 (mj1271) (see paper)
36% identity, 97% coverage: 5:182/183 of query aligns to 3:166/167 of 2pkpA
O14289 3-isopropylmalate dehydratase; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
35% identity, 73% coverage: 15:147/183 of query aligns to 554:684/758 of O14289
Sites not aligning to the query:
P9WK95 3-isopropylmalate dehydratase small subunit; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 76% coverage: 15:153/183 of query aligns to 18:155/198 of P9WK95
P09339 Aconitate hydratase A; ACN; Aconitase; Aconitate/2-methylaconitate hydratase; Iron-responsive protein-like; IRP-like; RNA-binding protein; EC 4.2.1.3; EC 4.2.1.- from Bacillus subtilis (strain 168) (see 2 papers)
25% identity, 64% coverage: 67:183/183 of query aligns to 781:889/909 of P09339
Sites not aligning to the query:
>2629599894 IMG__TrieryIMS101_FD:2629599894
MTKSLTGKIFVLDDNIDTDQIIPAEYLTLVPSKPDEYDKLGTYALCGLPDRYGRFMEPEA
MKTKYPIIVAGENFGCGSSREHAPIALGASGVQAVVAQSYARIFFRNCSATGELYPWESS
DRLCELFKTGQKVTIDFEKNQIVNHTLDQTYQLKSLGEVRPVIDAGGLFAYARQTGMISQ
KEV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory