SitesBLAST
Comparing 349653 FitnessBrowser__Btheta:349653 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7q4vB Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
63% identity, 93% coverage: 45:632/635 of query aligns to 7:596/599 of 7q4vB
- binding fe2/s2 (inorganic) cluster: C11 (= C49), C16 (= C54), C48 (= C86), F49 (= F87), L51 (≠ F89), C52 (= C90)
- binding flavin mononucleotide: G166 (= G204), G168 (= G206), N196 (= N232), D198 (= D234), F284 (= F320), G287 (= G323), E288 (= E324), E289 (= E325), N324 (= N360)
- binding iron/sulfur cluster: C457 (= C493), G458 (= G494), K459 (= K495), C460 (= C496), C463 (= C499), C503 (= C539), G506 (= G542), F544 (≠ Y580), C551 (= C587), K552 (≠ I588), G553 (= G589), C554 (= C590), G555 (≠ H591), I556 (≠ L592), C557 (= C593), C561 (= C597), P562 (= P598), Y574 (≠ H610), C581 (= C617), K583 (= K619), C584 (= C620), G585 (= G621), A586 (≠ M622), C587 (= C623), C591 (= C627), F593 (= F629), S595 (≠ A631)
- binding zinc ion: C440 (= C476), H527 (= H563), C533 (= C569)
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
56% identity, 92% coverage: 46:632/635 of query aligns to 28:627/630 of 8a6tB
- binding fe2/s2 (inorganic) cluster: C31 (= C49), G33 (= G51), C36 (= C54), C82 (= C86), F85 (= F89), C86 (= C90)
- binding flavin mononucleotide: G201 (= G206), N227 (= N232), E230 (= E235), N355 (= N360), G535 (= G540), L536 (= L541)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S320 (≠ E325), R337 (≠ K342), R340 (≠ F345), T341 (≠ P346), N342 (≠ A347), S433 (= S438)
- binding iron/sulfur cluster: S487 (= S492), C488 (= C493), G489 (= G494), C491 (= C496), C494 (= C499), C534 (= C539), L536 (= L541), G537 (= G542), Y575 (= Y580), I577 (= I582), C582 (= C587), I583 (= I588), C585 (= C590), C588 (= C593), C592 (= C597), A596 (= A601), I597 (= I602), I607 (= I612), C612 (= C617), C618 (= C623), C622 (= C627), K624 (≠ F629), A626 (= A631), I627 (= I632)
- binding zinc ion: C471 (= C476), H558 (= H563), C564 (= C569)
8oh5B Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
57% identity, 91% coverage: 56:634/635 of query aligns to 13:583/584 of 8oh5B
- binding fe2/s2 (inorganic) cluster: C41 (= C86), C45 (= C90)
- binding flavin mononucleotide: R154 (= R205), K164 (= K215), N181 (= N232), F269 (= F320), E273 (= E324), E274 (= E325), I307 (≠ V358), N308 (= N359), N309 (= N360), G489 (= G540), L490 (= L541)
- binding nicotinamide-adenine-dinucleotide: G155 (= G206), G156 (= G207), F159 (= F210), F163 (≠ L214), E273 (= E324), E274 (= E325), K291 (= K342), F294 (= F345), G413 (= G464)
- binding iron/sulfur cluster: P288 (= P339), C442 (= C493), G443 (= G494), C445 (= C496), C448 (= C499), C488 (= C539), L490 (= L541), G491 (= G542), I531 (= I582), C536 (= C587), T540 (≠ H591), C542 (= C593), C546 (= C597), P547 (= P598), V548 (≠ A599), H559 (= H610), C566 (= C617), T567 (≠ I618), K568 (= K619), C569 (= C620), C572 (= C623)
- binding zinc ion: C425 (= C476), H512 (= H563), C518 (= C569), C523 (= C574)
Sites not aligning to the query:
7q4vF Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
68% identity, 73% coverage: 168:632/635 of query aligns to 1:467/470 of 7q4vF
- binding flavin mononucleotide: G37 (= G204), G39 (= G206), N67 (= N232), G158 (= G323), E159 (= E324), E160 (= E325), G375 (= G540)
- binding nicotinamide-adenine-dinucleotide: G40 (= G207), F43 (= F210), K48 (= K215), R177 (≠ K342), F180 (= F345), M297 (= M462)
- binding iron/sulfur cluster: S327 (= S492), C328 (= C493), G329 (= G494), K330 (= K495), C331 (= C496), C334 (= C499), L373 (= L538), C374 (= C539), F415 (≠ Y580), I417 (= I582), C422 (= C587), G424 (= G589), C425 (= C590), G426 (≠ H591), I427 (≠ L592), C428 (= C593), C432 (= C597), P433 (= P598), I437 (= I602), Y445 (≠ H610), C452 (= C617), K454 (= K619), C455 (= C620), G456 (= G621), A457 (≠ M622), C458 (= C623), C462 (= C627), P463 (≠ K628), I467 (= I632)
- binding zinc ion: C311 (= C476), H398 (= H563), C404 (= C569), C409 (= C574)
8a5eB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from acetobacterium woodii in the reduced state (see paper)
69% identity, 69% coverage: 192:632/635 of query aligns to 2:444/447 of 8a5eB
- binding flavin mononucleotide: G14 (= G204), G16 (= G206), N44 (= N232), G135 (= G323), E137 (= E325), N171 (= N359), N172 (= N360), G352 (= G540)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G206), G17 (= G207), F20 (= F210), K25 (= K215), F28 (= F218), D49 (= D237), R154 (≠ K342), F157 (= F345), S250 (= S438)
- binding iron/sulfur cluster: P151 (= P339), C305 (= C493), G306 (= G494), K307 (= K495), C308 (= C496), C311 (= C499), C351 (= C539), G354 (= G542), F392 (≠ Y580), C399 (= C587), G401 (= G589), C402 (= C590), G403 (≠ H591), C405 (= C593), C409 (= C597), P410 (= P598), I414 (= I602), C429 (= C617), K431 (= K619), C432 (= C620), G433 (= G621), C435 (= C623), C439 (= C627), P440 (≠ K628), I444 (= I632)
- binding zinc ion: C288 (= C476), H375 (= H563), C381 (= C569), C386 (= C574)
7p8nB Tmhydabc- t. Maritima hydrogenase with bridge closed (see paper)
52% identity, 93% coverage: 44:632/635 of query aligns to 26:612/613 of 7p8nB
- binding fe2/s2 (inorganic) cluster: C31 (= C49), G33 (= G51), T34 (= T52), C36 (= C54), C67 (= C86), C68 (≠ F87), G69 (= G88), R70 (≠ F89), C71 (= C90)
- binding flavin mononucleotide: G185 (= G204), R186 (= R205), G187 (= G206), N213 (= N232), D215 (= D234), E216 (= E235), G217 (= G236), F301 (= F320), G304 (= G323), E305 (= E324), E306 (= E325), N340 (= N359), N341 (= N360), G521 (= G540), L522 (= L541)
- binding iron/sulfur cluster: P320 (= P339), S473 (= S492), C474 (= C493), G475 (= G494), K476 (= K495), C477 (= C496), C480 (= C499), L519 (= L538), C520 (= C539), L522 (= L541), G523 (= G542), Y560 (= Y580), C567 (= C587), C570 (= C590), G571 (≠ H591), C573 (= C593), C577 (= C597), Y590 (≠ H610), I592 (= I612), C597 (= C617), K599 (= K619), C600 (= C620), G601 (= G621), C603 (= C623), C607 (= C627)
- binding zinc ion: C457 (= C476), H544 (= H563), C549 (= C569), C554 (= C574)
7t30B Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/NAD(h) bound state (see paper)
66% identity, 67% coverage: 152:574/635 of query aligns to 2:424/425 of 7t30B
- binding fe2/s2 (inorganic) cluster: C326 (= C476), C364 (≠ T514), H413 (= H563), C419 (= C569), A421 (= A571), C424 (= C574)
- binding flavin mononucleotide: G54 (= G204), G56 (= G206), K65 (= K215), N82 (= N232), D84 (= D234), E85 (= E235), G173 (= G323), E175 (= E325), N210 (= N360), G390 (= G540), L391 (= L541)
- binding nicotinamide-adenine-dinucleotide: G56 (= G206), G57 (= G207), A58 (≠ G208), F60 (= F210), K65 (= K215), F68 (= F218), E85 (= E235), E175 (= E325), R192 (≠ K342), F195 (= F345), I312 (≠ M462), M313 (= M463), S315 (= S465)
- binding iron/sulfur cluster: S342 (= S492), C343 (= C493), G344 (= G494), C346 (= C496), C349 (= C499), S387 (≠ A537), C389 (= C539), L391 (= L541), G392 (= G542)
7t2rB Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state (see paper)
66% identity, 67% coverage: 152:574/635 of query aligns to 2:424/425 of 7t2rB
- binding fe2/s2 (inorganic) cluster: C326 (= C476), D329 (≠ S479), C364 (≠ T514), H413 (= H563), C419 (= C569), A421 (= A571), C424 (= C574)
- binding iron/sulfur cluster: P189 (= P339), C343 (= C493), G344 (= G494), C346 (= C496), C349 (= C499), C389 (= C539), G392 (= G542)
Q56222 NADH-quinone oxidoreductase subunit 1; NADH dehydrogenase I chain 1; NDH-1 subunit 1; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
47% identity, 65% coverage: 155:567/635 of query aligns to 15:428/438 of Q56222
4hea1 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
47% identity, 65% coverage: 155:567/635 of query aligns to 14:427/437 of 4hea1
- binding flavin mononucleotide: G63 (= G204), K74 (= K215), N91 (= N232), D93 (= D234), Y179 (≠ F320), G182 (= G323), E183 (= E324), N218 (= N359), N219 (= N360), L401 (= L541)
- binding iron/sulfur cluster: I180 (≠ V321), P198 (= P339), S351 (= S492), C352 (= C493), G353 (= G494), K354 (= K495), C355 (= C496), C358 (= C499), F398 (≠ L538), C399 (= C539), L401 (= L541)
2ybb1 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
47% identity, 65% coverage: 155:567/635 of query aligns to 14:427/437 of 2ybb1
- binding flavin mononucleotide: G63 (= G204), G65 (= G206), N91 (= N232), D93 (= D234), G182 (= G323), E183 (= E324), E184 (= E325), N218 (= N359), N219 (= N360), T222 (= T363), P400 (≠ G540)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G65 (= G206), G66 (= G207), F69 (= F210), K74 (= K215), F77 (= F218), E96 (≠ D237), Y179 (≠ F320), E184 (= E325), K201 (= K342), F204 (= F345), T324 (≠ S465)
- binding iron/sulfur cluster: S351 (= S492), C352 (= C493), K354 (= K495), C355 (= C496), C358 (= C499), F398 (≠ L538), C399 (= C539), L401 (= L541), A402 (≠ G542)
6vw7D Formate dehydrogenase fdsabg subcomplex fdsbg from c. Necator - nadh bound (see paper)
44% identity, 66% coverage: 144:560/635 of query aligns to 95:510/514 of 6vw7D
- binding flavin mononucleotide: G154 (= G204), G156 (= G206), K165 (= K215), N182 (= N232), E185 (= E235), G273 (= G323), E274 (= E324), E275 (= E325), N309 (= N359), N310 (= N360), S313 (≠ T363), A490 (≠ G540), M491 (≠ L541)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A158 (≠ G208), F160 (= F210), K165 (= K215), T168 (≠ F218), E275 (= E325), L295 (≠ F345)
- binding iron/sulfur cluster: V271 (= V321), V289 (≠ P339), S442 (= S492), C443 (= C493), G444 (= G494), K445 (= K495), C446 (= C496), C449 (= C499), L488 (= L538), C489 (= C539), M491 (≠ L541), G492 (= G542)
6saqB Wild-type nuoef from aquifex aeolicus bound to nadh-oh (see paper)
46% identity, 63% coverage: 168:567/635 of query aligns to 29:419/419 of 6saqB
- binding flavin mononucleotide: G64 (= G204), G66 (= G206), K75 (= K215), N91 (= N232), D93 (= D234), E94 (= E235), Y179 (≠ F320), G182 (= G323), E183 (= E324), N218 (= N359), N219 (= N360), T222 (= T363)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-5-[[(1~{E},3~{Z})-5-azanyl-4-oxidanyl-5-oxidanylidene-penta-1,3-dienyl]-methanoyl-amino]-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: G66 (= G206), G67 (= G207), A68 (≠ G208), F70 (= F210), K75 (= K215), E94 (= E235), E96 (≠ D237), T99 (≠ A240), E184 (= E325), Y204 (≠ F345), T318 (≠ S465)
- binding iron/sulfur cluster: P198 (= P339), T345 (≠ S492), C346 (= C493), G347 (= G494), Q348 (≠ K495), C349 (= C496), C352 (= C499), I391 (≠ L538), C392 (= C539), G395 (= G542)
6hl3B Wild-type nuoef from aquifex aeolicus - oxidized form bound to NAD+ (see paper)
45% identity, 62% coverage: 168:563/635 of query aligns to 28:415/416 of 6hl3B
- binding flavin mononucleotide: G63 (= G204), G65 (= G206), K74 (= K215), N90 (= N232), D92 (= D234), E93 (= E235), G181 (= G323), E182 (= E324), E183 (= E325), V216 (= V358), N217 (= N359), N218 (= N360), T221 (= T363)
- binding nicotinamide-adenine-dinucleotide: G65 (= G206), G66 (= G207), A67 (≠ G208), F69 (= F210), K74 (= K215), E95 (≠ D237), Y178 (≠ F320), E183 (= E325), K200 (= K342), Y203 (≠ F345)
- binding iron/sulfur cluster: I179 (≠ V321), P197 (= P339), T344 (≠ S492), C345 (= C493), G346 (= G494), Q347 (≠ K495), C348 (= C496), C351 (= C499), S389 (≠ A537), I390 (≠ L538), C391 (= C539), L393 (= L541), G394 (= G542)
7q5yC Structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus
45% identity, 62% coverage: 168:563/635 of query aligns to 30:417/419 of 7q5yC
- binding flavin mononucleotide: G65 (= G204), G67 (= G206), K76 (= K215), N92 (= N232), E95 (= E235), Y180 (≠ F320), G183 (= G323), E184 (= E324), V218 (= V358), N219 (= N359), N220 (= N360), T223 (= T363)
- binding iron/sulfur cluster: T346 (≠ S492), C347 (= C493), G348 (= G494), Q349 (≠ K495), C350 (= C496), C353 (= C499), S391 (≠ A537), I392 (≠ L538), C393 (= C539), G396 (= G542)
6q9cB Crystal structure of aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe and nuof bound to nadh under anaerobic conditions (see paper)
45% identity, 62% coverage: 168:563/635 of query aligns to 29:416/418 of 6q9cB
- binding flavin mononucleotide: G64 (= G204), G66 (= G206), K75 (= K215), N91 (= N232), D93 (= D234), E94 (= E235), G182 (= G323), E183 (= E324), E184 (= E325), V217 (= V358), N218 (= N359), N219 (= N360), T222 (= T363), G393 (= G540)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G66 (= G206), G67 (= G207), A68 (≠ G208), F70 (= F210), K75 (= K215), E94 (= E235), E96 (≠ D237), Y179 (≠ F320), E184 (= E325), Y204 (≠ F345)
- binding iron/sulfur cluster: P198 (= P339), T345 (≠ S492), C346 (= C493), G347 (= G494), Q348 (≠ K495), C349 (= C496), C352 (= C499), I391 (≠ L538), C392 (= C539), L394 (= L541), G395 (= G542)
7p61F Complex i from e. Coli, ddm-purified, with nadh, resting state (see paper)
43% identity, 62% coverage: 169:560/635 of query aligns to 26:419/442 of 7p61F
- binding flavin mononucleotide: G61 (= G204), G63 (= G206), K72 (= K215), N90 (= N232), D92 (= D234), G181 (= G323), E182 (= E324), N217 (= N359), N218 (= N360), A399 (≠ G540), H400 (≠ L541)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G63 (= G206), G64 (= G207), A65 (≠ G208), F67 (= F210), K72 (= K215), L75 (≠ F218), E95 (≠ D237), Y178 (≠ F320), E183 (= E325), F203 (= F345), R320 (≠ M462), T323 (≠ S465)
- binding iron/sulfur cluster: S350 (= S492), C351 (= C493), W353 (≠ K495), C354 (= C496), C357 (= C499), F397 (≠ L538), C398 (= C539), H400 (≠ L541)
6tg9B Cryo-em structure of nadh reduced form of NAD+-dependent formate dehydrogenase from rhodobacter capsulatus (see paper)
41% identity, 66% coverage: 145:560/635 of query aligns to 88:492/493 of 6tg9B
- binding flavin mononucleotide: G146 (= G204), R147 (= R205), G148 (= G206), N174 (= N232), D176 (= D234), E177 (= E235), Y254 (≠ F320), G257 (= G323), E258 (= E324), N293 (= N359), N294 (= N360), S297 (≠ T363)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F152 (= F210), K157 (= K215), E258 (= E324), E259 (= E325), L279 (≠ F345), K466 (= K534), L470 (= L538)
- binding iron/sulfur cluster: S426 (= S492), C427 (= C493), G428 (= G494), T429 (≠ K495), C430 (= C496), C433 (= C499), L470 (= L538), C471 (= C539), G474 (= G542)
8e9hF Mycobacterial respiratory complex i, fully-inserted quinone (see paper)
41% identity, 63% coverage: 168:564/635 of query aligns to 18:421/436 of 8e9hF
- binding flavin mononucleotide: G53 (= G204), R54 (= R205), G55 (= G206), A57 (≠ G208), K64 (= K215), N90 (= N232), D92 (= D234), Y178 (≠ F320), G181 (= G323), E182 (= E324), E183 (= E325), N217 (= N359), N218 (= N360), S221 (≠ T363), L398 (= L541)
- binding iron/sulfur cluster: P197 (= P339), S349 (= S492), C350 (= C493), G351 (= G494), K352 (= K495), C353 (= C496), C356 (= C499), S394 (≠ A537), F395 (≠ L538), C396 (= C539), L398 (= L541), G399 (= G542)
- binding zinc ion: C333 (= C476), E371 (≠ T514), H420 (= H563)
Sites not aligning to the query:
5lnk1 Entire ovine respiratory complex i (see paper)
41% identity, 62% coverage: 174:565/635 of query aligns to 32:425/432 of 5lnk1
- binding fe2/s2 (inorganic) cluster: P96 (= P238), G97 (= G239)
- binding flavin mononucleotide: G61 (= G204), R62 (= R205), K72 (= K215), N90 (= N232), D92 (= D234), E93 (= E235), G94 (= G236), Y178 (≠ F320), G181 (= G323), E182 (= E324), V216 (= V358), A217 (≠ N359), N218 (= N360), T221 (= T363), L401 (= L541)
- binding iron/sulfur cluster: P197 (= P339), S352 (= S492), C353 (= C493), Q355 (≠ K495), C356 (= C496), C359 (= C499), T397 (≠ A537), I398 (≠ L538), C399 (= C539)
Query Sequence
>349653 FitnessBrowser__Btheta:349653
MKILSIHDLQIIRKRAEHHLSLREESNEKVSEKCCGLASGTTHLQILICGGTGCKASSSQ
GITENLQKAIERNGITDKVDVITVGCFGFCEKGPIVKIIPDNTFYTQVTPEDAEEIISEH
IIGGRRIERLLYIDPKTEQTVSDSKHMDFYRKQLRIALRNCGFIDSENIEEYIAREGYFA
LADCLLNKQPADVIDIIKRSGLRGRGGGGFPTGLKWEFASKQVSNVKYVVCNADEGDPGA
FMDRSIMEGDPHSIVEAMCICGYSIGSSKGLVYIRAEYPLAINRLKKAIEQAREYGLLGD
HILGTDFSFDIEIRYGAGAFVCGEETALIHSMEGKRGEPTLKPPFPAESGYLGKPTNVNN
VETLANIPIILTKGAEWFASIGTERSKGTKVFALAGKINNVGLIEVPMGTTLREVIYEIG
GGIKGGKKFKAVQTGGPSGGCLTEKHLDTPIDFDNLLAAGSMMGSGGMIVMDEDDCMVSV
ARFYLDFTVEESCGKCTPCRIGNKRLLELLNKITEGRGTEKDLDTLATLGRVIKDTALCG
LGQTSPNPVLSTLDNFRDEYLEHVRDKTCRAKQCKSLLTYTINPELCIGCHLCAKNCPAD
AISGLVRKPHVIHPEKCIKCGMCMARCKFKAILVC
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory