SitesBLAST
Comparing 349658 FitnessBrowser__Btheta:349658 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4wuvA Crystal structure of a putative d-mannonate oxidoreductase from haemophilus influenza (avi_5165, target efi-513796) with bound NAD
42% identity, 98% coverage: 6:271/271 of query aligns to 7:280/280 of 4wuvA
- binding nicotinamide-adenine-dinucleotide: G17 (= G16), G20 (= G19), V21 (= V20), L22 (= L21), D41 (= D40), L42 (≠ I41), T66 (≠ G65), N67 (≠ D66), V68 (= V67), G94 (≠ I93), G96 (= G95), L134 (= L123), I161 (≠ V150), Y176 (= Y165), K180 (= K169)
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
32% identity, 97% coverage: 5:267/271 of query aligns to 3:248/249 of 3uf0A
- active site: G18 (≠ V20), S141 (= S152), V151 (= V162), Y154 (= Y165), K158 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G16), S17 (≠ G19), G18 (≠ V20), I19 (≠ L21), R39 (= R42), D63 (= D66), L64 (≠ V67), N89 (≠ I93), G91 (= G95), I92 (≠ L103), I139 (≠ V150), A140 (≠ S151), S141 (= S152), Y154 (= Y165), K158 (= K169), P184 (= P198), G185 (= G199), V187 (≠ F201), T189 (≠ D204), N191 (= N206), T192 (≠ R207)
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
30% identity, 97% coverage: 5:267/271 of query aligns to 6:246/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G16), D19 (≠ G18), L22 (= L21), I42 (= I41), D65 (= D66), M66 (≠ V67), N92 (≠ I93), A93 (= A94), G94 (= G95), L115 (= L123), I143 (≠ V150), S145 (= S152), Y158 (= Y165), K162 (= K169), G189 (= G199), M191 (≠ F201), T193 (≠ G203), N195 (≠ Q205)
3lqfA Crystal structure of the short-chain dehydrogenase galactitol- dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD and erythritol (see paper)
34% identity, 98% coverage: 4:268/271 of query aligns to 6:254/254 of 3lqfA
- active site: G22 (≠ V20), S144 (= S152), Y159 (= Y165), K163 (= K169)
- binding meso-erythritol: N151 (≠ R161), Y159 (= Y165), Y191 (≠ F200), T197 (≠ N206), M200 (≠ V209)
- binding nicotinamide-adenine-dinucleotide: G18 (= G16), S21 (≠ G19), G22 (≠ V20), I23 (≠ L21), D42 (= D40), R43 (≠ I41), D66 (= D66), V67 (= V67), S92 (≠ I93), L142 (≠ V150), S144 (= S152), K163 (= K169), P189 (= P198), V192 (≠ F201), T194 (≠ G203), M196 (≠ Q205), T197 (≠ N206)
2wsbA Crystal structure of the short-chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD (see paper)
34% identity, 98% coverage: 4:268/271 of query aligns to 6:254/254 of 2wsbA
- active site: G22 (≠ V20), S144 (= S152), Y159 (= Y165), K163 (= K169)
- binding nicotinamide-adenine-dinucleotide: G18 (= G16), S21 (≠ G19), G22 (≠ V20), I23 (≠ L21), D42 (= D40), R43 (≠ I41), D66 (= D66), V67 (= V67), S92 (≠ I93), A93 (= A94), L142 (≠ V150), S144 (= S152), Y159 (= Y165), K163 (= K169), P189 (= P198), V192 (≠ F201), T194 (≠ G203), M196 (≠ Q205), T197 (≠ N206)
- binding n-propanol: S144 (= S152), M145 (= M153), N151 (≠ R161), N151 (≠ R161), Y159 (= Y165), Y159 (= Y165), Y191 (≠ F200)
2wdzA Crystal structure of the short chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD+ and 1,2-pentandiol (see paper)
34% identity, 98% coverage: 4:268/271 of query aligns to 6:254/254 of 2wdzA
- active site: G22 (≠ V20), S144 (= S152), Y159 (= Y165), K163 (= K169)
- binding (2S)-pentane-1,2-diol: A45 (≠ Q43), D49 (= D47), R62 (vs. gap), S146 (≠ A154), Y159 (= Y165)
- binding nicotinamide-adenine-dinucleotide: G18 (= G16), S21 (≠ G19), G22 (≠ V20), I23 (≠ L21), D42 (= D40), R43 (≠ I41), A65 (≠ G65), D66 (= D66), V67 (= V67), S92 (≠ I93), A93 (= A94), L142 (≠ V150), S144 (= S152), Y159 (= Y165), K163 (= K169), P189 (= P198), V192 (≠ F201), T194 (≠ G203), M196 (≠ Q205), T197 (≠ N206)
C0KTJ6 Galactitol 2-dehydrogenase (L-tagatose-forming); Galactitol dehydrogenase; GDH; GatDH; Galactitol:NAD(+) 5-oxidoreductase; EC 1.1.1.406 from Cereibacter sphaeroides (Rhodobacter sphaeroides) (see paper)
34% identity, 98% coverage: 4:268/271 of query aligns to 6:254/254 of C0KTJ6
6vspB Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
32% identity, 96% coverage: 10:270/271 of query aligns to 8:248/252 of 6vspB
H9XP47 Meso-2,3-butanediol dehydrogenase; BDH; meso-2,3-BDH; (R,S)-butane-2,3-diol dehydrogenase; NAD(H)-dependent meso-2,3-BDH; SmBdh; EC 1.1.1.- from Serratia marcescens (see paper)
32% identity, 96% coverage: 10:270/271 of query aligns to 6:246/251 of H9XP47
- N15 (≠ G19) binding
- M17 (≠ L21) binding
- D36 (= D40) binding
- D60 (= D66) binding
- V61 (= V67) binding
- N87 (≠ I93) binding
- S138 (= S152) binding ; binding
- V139 (≠ M153) mutation to Q: Retains 50% of activity with acetoin as substrate; when associated with A-247.
- S140 (≠ A154) binding
- Y151 (= Y165) binding ; binding ; binding
- K155 (= K169) binding
- V184 (≠ F201) binding
- T186 (≠ G203) binding
- RDK 197:199 (≠ SKK 221:223) mutation to SEAAGKPLGYGTET: Mimics longer alpha6 helix. Retains 3% of activity with acetoin as substrate.
Sites not aligning to the query:
- 247 Q→A: Retains 10% of activity with acetoin as substrate. Retains 50% of activity with acetoin as substrate; when associated with Q-139.
6vspA Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
32% identity, 96% coverage: 10:270/271 of query aligns to 6:246/251 of 6vspA
- active site: G16 (≠ V20), S138 (= S152), Y151 (= Y165)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), N15 (≠ G19), G16 (≠ V20), M17 (≠ L21), D36 (= D40), W37 (≠ I41), W37 (≠ I41), A38 (≠ R42), I59 (= I63), D60 (= D66), V61 (= V67), N87 (≠ I93), A88 (= A94), G89 (= G95), V90 (≠ G96), V110 (≠ L123), T136 (≠ V150), S138 (= S152), Y151 (= Y165), K155 (= K169), P181 (= P198), S182 (≠ G199), L183 (≠ F200), V184 (≠ F201), T186 (≠ G203), N187 (≠ D204), M188 (≠ Q205), T189 (≠ N206)
6xewA Structure of serratia marcescens 2,3-butanediol dehydrogenase (see paper)
32% identity, 96% coverage: 10:270/271 of query aligns to 6:246/251 of 6xewA
- active site: G16 (≠ V20), S138 (= S152), Y151 (= Y165)
- binding r,3-hydroxybutan-2-one: S138 (= S152), S140 (≠ A154), Y151 (= Y165)
- binding s,3-hydroxybutan-2-one: S138 (= S152), Y151 (= Y165), S182 (≠ G199)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), N15 (≠ G19), G16 (≠ V20), M17 (≠ L21), D36 (= D40), W37 (≠ I41), W37 (≠ I41), A38 (≠ R42), I59 (= I63), D60 (= D66), V61 (= V67), N87 (≠ I93), A88 (= A94), G89 (= G95), V110 (≠ L123), T136 (≠ V150), S138 (= S152), Y151 (= Y165), K155 (= K169), S182 (≠ G199), L183 (≠ F200), V184 (≠ F201), T186 (≠ G203), N187 (≠ D204), M188 (≠ Q205), T189 (≠ N206)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
32% identity, 96% coverage: 5:265/271 of query aligns to 1:241/244 of P0A2C9
- M125 (= M139) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (≠ C247) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S248) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
6ow4F Structure of the nadh-bound form of 20beta-hydroxysteroid dehydrogenase from bifidobacterium adolescentis strain l2-32 (see paper)
32% identity, 97% coverage: 5:268/271 of query aligns to 27:284/284 of 6ow4F
- binding nicotinamide-adenine-dinucleotide: G38 (= G16), G41 (= G19), L43 (= L21), D62 (= D40), L63 (≠ I41), V92 (= V67), N118 (≠ I93), G120 (= G95), T169 (≠ V150), A171 (≠ S152), Y190 (= Y165), K194 (= K169), P220 (= P198), V223 (vs. gap), S225 (≠ I202)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
33% identity, 96% coverage: 6:265/271 of query aligns to 2:237/239 of 4nbtA
- active site: G16 (≠ V20), S132 (= S152), Y145 (= Y165), K149 (= K169)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), K15 (≠ G19), G16 (≠ V20), L17 (= L21), D36 (= D40), L37 (≠ I41), L52 (≠ G65), N53 (≠ D66), V54 (= V67), N80 (≠ I93), A81 (= A94), G82 (= G95), I130 (≠ V150), S132 (= S152), Y145 (= Y165), K149 (= K169), P177 (= P198), G178 (= G199), I180 (≠ F201), T182 (≠ G203)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
32% identity, 96% coverage: 5:265/271 of query aligns to 1:241/244 of 6t77A
- active site: G16 (≠ V20), S138 (= S152), Y151 (= Y165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), S14 (≠ G18), R15 (≠ G19), T37 (≠ I41), L58 (≠ G65), N59 (≠ D66), V60 (= V67), A87 (= A94), G88 (= G95), I89 (≠ L103)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
33% identity, 94% coverage: 10:265/271 of query aligns to 8:242/244 of 4nbuB
- active site: G18 (≠ V20), N111 (= N124), S139 (= S152), Q149 (≠ V162), Y152 (= Y165), K156 (= K169)
- binding acetoacetyl-coenzyme a: D93 (= D106), K98 (≠ D111), S139 (= S152), N146 (≠ I159), V147 (≠ T160), Q149 (≠ V162), Y152 (= Y165), F184 (= F200), M189 (≠ R208), K200 (= K223)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G16), N17 (≠ G19), G18 (≠ V20), I19 (≠ L21), D38 (= D40), F39 (≠ I41), V59 (≠ G65), D60 (= D66), V61 (= V67), N87 (≠ I93), A88 (= A94), G89 (= G95), I90 (≠ L103), T137 (≠ V150), S139 (= S152), Y152 (= Y165), K156 (= K169), P182 (= P198), F184 (= F200), T185 (≠ D204), T187 (≠ N206), M189 (≠ R208)
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
31% identity, 95% coverage: 9:265/271 of query aligns to 4:240/243 of 1q7bA
- active site: G15 (≠ V20), E101 (≠ C116), S137 (= S152), Q147 (≠ V162), Y150 (= Y165), K154 (= K169)
- binding calcium ion: E232 (≠ A257), T233 (≠ M258)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G16), S13 (≠ G18), R14 (≠ G19), T36 (≠ I41), N58 (≠ D66), V59 (= V67), N85 (≠ I93), A86 (= A94), G87 (= G95), I88 (≠ L103), S137 (= S152), Y150 (= Y165), K154 (= K169), P180 (= P198), G181 (= G199), I183 (≠ F201)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 95% coverage: 9:265/271 of query aligns to 5:241/244 of P0AEK2
- GASR 12:15 (≠ GAGG 16:19) binding
- T37 (≠ I41) binding
- NV 59:60 (≠ DV 66:67) binding
- N86 (≠ I93) binding
- Y151 (= Y165) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YSAAK 165:169) binding
- A154 (= A168) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K169) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ F201) binding
- E233 (≠ A257) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
31% identity, 95% coverage: 10:267/271 of query aligns to 6:247/248 of 6ixmC
- active site: G16 (≠ V20), S142 (= S152), Y155 (= Y165), K159 (= K169)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), S15 (≠ G19), G16 (≠ V20), I17 (≠ L21), D36 (= D40), I37 (= I41), A61 (≠ G65), D62 (= D66), T63 (≠ V67), N89 (≠ I93), A90 (= A94), M140 (≠ V150), S142 (= S152), Y155 (= Y165), K159 (= K169), P185 (= P198), A186 (≠ G199), Y187 (≠ F200), I188 (≠ F201), L192 (= L210)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
32% identity, 96% coverage: 7:265/271 of query aligns to 3:241/244 of 7krmC
- active site: G18 (vs. gap), S140 (= S152), Y155 (= Y165)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), S15 (≠ G19), G18 (vs. gap), I19 (≠ L21), D38 (= D40), L39 (≠ I41), A60 (≠ G65), N61 (≠ D66), V62 (= V67), N88 (≠ I93), V111 (≠ L123), S140 (= S152), Y155 (= Y165), K159 (= K169), I188 (≠ F201), T190 (≠ G203)
Query Sequence
>349658 FitnessBrowser__Btheta:349658
MNELFSIAGKVAVITGAGGVLGGNIAQHFVQQGAKVVAIDIRQEQLDNRVAELKQYGQDV
IGIIGDVLDIASLEKVAEEIVAQWGQIDILLNIAGGNMPGATLESDQNFYDMDISCWEKV
TSLNMNGTVYPSMIFGKVMAEQKKGCIINVSSMAAYSAITRVPGYSAAKTAVANFTQWLA
SEMALKYGDGIRVNAIAPGFFIGDQNRRVLINPDGSLTDRSKKVLAKTPMNRFGDIKELN
GAVQFLCSEAASFVTGAMLPIDGGFSAFSGV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory