Comparing 349724 FitnessBrowser__Btheta:349724 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
P0AGC0 Hexose-6-phosphate:phosphate antiporter from Escherichia coli (strain K12) (see paper)
28% identity, 83% coverage: 36:408/448 of query aligns to 30:413/463 of P0AGC0
Sites not aligning to the query:
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
23% identity, 59% coverage: 49:314/448 of query aligns to 29:303/430 of P0AA76
Sites not aligning to the query:
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
22% identity, 59% coverage: 49:314/448 of query aligns to 18:284/409 of 6e9nA
Sites not aligning to the query:
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
23% identity, 59% coverage: 49:314/448 of query aligns to 21:268/393 of 6e9oA
Sites not aligning to the query:
Q9NYB5 Solute carrier organic anion transporter family member 1C1; Organic anion transporter 1C1; OATP1C1; Organic anion transporter F; OATP-F; Organic anion transporter polypeptide-related protein 5; OAT-RP-5; OATP-RP5; Organic anion-transporting polypeptide 14; OATP-14; Solute carrier family 21 member 14; Thyroxine transporter from Homo sapiens (Human) (see paper)
23% identity, 29% coverage: 188:315/448 of query aligns to 273:417/712 of Q9NYB5
Sites not aligning to the query:
>349724 FitnessBrowser__Btheta:349724
MLKHLINFYKVSSPGPCNGDVMSSSGKRRLKYLQWSTFLSATFGYGMYYVCRLSLNVVKK
PIVDEGIFSETELGIIGSVLFFTYAVGKFTNGFLADRSNINRFMTTGLLVTALINLCLGF
SHSFILFAVLWGVSGWFQSMGAASCVVGLSRWFTDKERGSYYGFWSASHNIGEALTFIIV
ASIVSVCGWRYGFFGAGMVGLLGALIVWRFFHDSPESKGFPPVNVPKEKKTMSASETTDF
NKAQRQVLTMPAIWILALSSAFMYISRYAVNSWGVFYLEAQKGYSTLDASFIISISSVCG
IIGTMFSGVISDKLFGGRRNVPALIFGLTNVLALCLFLLVPGVHFWLDAVAMILFGLGIG
VLICFLGGLMAVDIAPRNASGAALGVVGIASYIGAGLQDVMSGVLIEGHKTIRSGVEVYD
FTYINWFWIGSAILSVFFALWVWNAKQK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory