SitesBLAST
Comparing 349837 FitnessBrowser__Btheta:349837 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6uziC Crystal structure of dihydrolipoyl dehydrogenase from elizabethkingia anophelis nuhp1
37% identity, 99% coverage: 2:444/447 of query aligns to 6:457/470 of 6uziC
- active site: C45 (= C40), C50 (= C45), S53 (≠ T48), V187 (= V180), E191 (= E184), H448 (= H435), E453 (= E440)
- binding flavin-adenine dinucleotide: I12 (= I8), G13 (= G9), G15 (= G11), P16 (= P12), G17 (≠ A13), E36 (= E32), K37 (= K33), G43 (= G38), T44 (≠ V39), C45 (= C40), G49 (= G44), C50 (= C45), S53 (≠ T48), K54 (= K49), V117 (≠ E111), G118 (≠ A112), T147 (= T140), G148 (= G141), I188 (= I181), R276 (= R264), D316 (= D303), M322 (≠ L309), L323 (= L310), A324 (= A311)
- binding zinc ion: H448 (= H435), E453 (= E440)
2eq6A Crystal structure of lipoamide dehydrogenase from thermus thermophilus hb8
38% identity, 99% coverage: 2:444/447 of query aligns to 3:446/460 of 2eq6A
- active site: V37 (≠ I36), C41 (= C40), C46 (= C45), T49 (= T48), A176 (≠ V180), E180 (= E184), H435 (≠ F433), H437 (= H435), E442 (= E440)
- binding flavin-adenine dinucleotide: I9 (= I8), G10 (= G9), G12 (= G11), P13 (= P12), G14 (≠ A13), E33 (= E32), A34 (≠ K33), G39 (= G38), V40 (= V39), C41 (= C40), G45 (= G44), C46 (= C45), K50 (= K49), F111 (≠ E111), A112 (= A112), A135 (≠ C139), T136 (= T140), G137 (= G141), S155 (= S160), R269 (≠ N267), D306 (= D303), L312 (= L309), L313 (= L310), A314 (= A311), H315 (= H312), Y344 (= Y342)
Sites not aligning to the query:
3urhB Crystal structure of a dihydrolipoamide dehydrogenase from sinorhizobium meliloti 1021
35% identity, 99% coverage: 3:444/447 of query aligns to 1:454/465 of 3urhB
- active site: Y35 (vs. gap), C39 (= C40), C44 (= C45), S47 (≠ T48), V183 (= V180), E187 (= E184), H443 (≠ F433), H445 (= H435), E450 (= E440)
- binding flavin-adenine dinucleotide: I6 (= I8), G7 (= G9), G9 (= G11), P10 (= P12), G11 (≠ A13), E30 (= E32), K31 (= K33), G37 (= G38), T38 (≠ V39), C39 (= C40), G43 (= G44), C44 (= C45), K48 (= K49), T111 (≠ L121), G112 (≠ I122), A140 (≠ C139), T141 (= T140), G142 (= G141), I184 (= I181), R273 (= R264), G312 (= G302), D313 (= D303), M319 (≠ L309), L320 (= L310), A321 (= A311), H322 (= H312)
P11959 Dihydrolipoyl dehydrogenase; Dihydrolipoamide dehydrogenase; E3 component of pyruvate complex; EC 1.8.1.4 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
35% identity, 98% coverage: 7:444/447 of query aligns to 14:455/470 of P11959
- 39:47 (vs. 32:40, 67% identical) binding
- K56 (= K49) binding
- D314 (= D303) binding
- A322 (= A311) binding
1ebdA Dihydrolipoamide dehydrogenase complexed with the binding domain of the dihydrolipoamide acetylase (see paper)
35% identity, 98% coverage: 7:444/447 of query aligns to 8:449/455 of 1ebdA
- active site: P13 (= P12), L37 (≠ I36), C41 (= C40), C46 (= C45), S49 (≠ T48), N74 (≠ S73), V75 (≠ P74), Y180 (≠ V180), E184 (= E184), S320 (≠ I315), H438 (≠ F433), H440 (= H435), E445 (= E440)
- binding flavin-adenine dinucleotide: G10 (= G9), G12 (= G11), P13 (= P12), V32 (≠ F31), E33 (= E32), K34 (= K33), G39 (= G38), V40 (= V39), C41 (= C40), G45 (= G44), C46 (= C45), K50 (= K49), E112 (= E111), A113 (= A112), T141 (= T140), G142 (= G141), Y180 (≠ V180), I181 (= I181), R268 (= R264), D308 (= D303), A314 (≠ L309), L315 (= L310), A316 (= A311)
2eq7A Crystal structure of lipoamide dehydrogenase from thermus thermophilus hb8 with psbdo
35% identity, 99% coverage: 3:444/447 of query aligns to 2:443/452 of 2eq7A
- active site: P11 (= P12), L36 (≠ I36), C40 (= C40), C45 (= C45), S48 (≠ T48), G72 (≠ S73), V73 (≠ P74), V177 (= V180), E181 (= E184), S314 (≠ I315), H432 (≠ F433), H434 (= H435), E439 (= E440)
- binding flavin-adenine dinucleotide: G10 (= G11), P11 (= P12), G12 (≠ A13), E31 (= E32), K32 (= K33), G38 (= G38), T39 (≠ V39), C40 (= C40), R42 (≠ N42), G44 (= G44), C45 (= C45), K49 (= K49), T110 (≠ E111), A111 (= A112), T137 (= T140), G138 (= G141), S157 (= S160), I178 (= I181), R262 (= R264), Y265 (≠ N267), D302 (= D303), M308 (≠ L309), L309 (= L310), A310 (= A311), H311 (= H312), Y341 (= Y342)
- binding nicotinamide-adenine-dinucleotide: W146 (≠ I149), G174 (= G177), G176 (= G179), V177 (= V180), I178 (= I181), E197 (= E200), Y198 (≠ M201), V231 (= V234), V260 (= V262), G261 (= G263), R262 (= R264), M308 (≠ L309), L309 (= L310), V339 (= V340)
2yquB Crystal structures and evolutionary relationship of two different lipoamide dehydrogenase(e3s) from thermus thermophilus
35% identity, 99% coverage: 3:444/447 of query aligns to 2:443/455 of 2yquB
- active site: P11 (= P12), L36 (≠ I36), C40 (= C40), C45 (= C45), S48 (≠ T48), G72 (≠ S73), V73 (≠ P74), V177 (= V180), E181 (= E184), S314 (≠ I315), H432 (≠ F433), H434 (= H435), E439 (= E440)
- binding carbonate ion: A310 (= A311), S314 (≠ I315), S423 (≠ T424), D426 (≠ E427)
- binding flavin-adenine dinucleotide: G8 (= G9), G10 (= G11), P11 (= P12), G12 (≠ A13), E31 (= E32), K32 (= K33), G38 (= G38), T39 (≠ V39), C40 (= C40), R42 (≠ N42), G44 (= G44), C45 (= C45), K49 (= K49), T110 (≠ E111), A111 (= A112), T137 (= T140), G138 (= G141), I178 (= I181), Y265 (≠ N267), G301 (= G302), D302 (= D303), M308 (≠ L309), L309 (= L310), A310 (= A311), H311 (= H312)
2yquA Crystal structures and evolutionary relationship of two different lipoamide dehydrogenase(e3s) from thermus thermophilus
35% identity, 99% coverage: 3:444/447 of query aligns to 2:443/455 of 2yquA
- active site: P11 (= P12), L36 (≠ I36), C40 (= C40), C45 (= C45), S48 (≠ T48), G72 (≠ S73), V73 (≠ P74), V177 (= V180), E181 (= E184), S314 (≠ I315), H432 (≠ F433), H434 (= H435), E439 (= E440)
- binding flavin-adenine dinucleotide: G8 (= G9), G10 (= G11), P11 (= P12), G12 (≠ A13), E31 (= E32), K32 (= K33), G38 (= G38), T39 (≠ V39), C40 (= C40), R42 (≠ N42), G44 (= G44), C45 (= C45), K49 (= K49), T110 (≠ E111), A111 (= A112), T137 (= T140), G138 (= G141), S157 (= S160), I178 (= I181), Y265 (≠ N267), G301 (= G302), D302 (= D303), M308 (≠ L309), L309 (= L310), A310 (= A311)
4jdrA Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase from escherichia coli (see paper)
34% identity, 98% coverage: 5:440/447 of query aligns to 8:449/471 of 4jdrA
- active site: P15 (= P12), L40 (≠ I36), C44 (= C40), C49 (= C45), S52 (≠ T48), E77 (≠ S73), P78 (= P74), I184 (≠ V180), E188 (= E184), V324 (≠ I315), H442 (≠ F433), H444 (= H435), E449 (= E440)
- binding flavin-adenine dinucleotide: G12 (= G9), G14 (= G11), P15 (= P12), A16 (= A13), E35 (= E32), R36 (≠ K33), Y37 (vs. gap), V43 (= V39), C44 (= C40), G48 (= G44), C49 (= C45), K53 (= K49), L115 (≠ E111), G116 (≠ A112), A144 (≠ T140), G145 (= G141), I185 (= I181), G311 (= G302), D312 (= D303), M318 (≠ L309), L319 (= L310), A320 (= A311), H321 (= H312)
Sites not aligning to the query:
P0A9P0 Dihydrolipoyl dehydrogenase; Dihydrolipoamide dehydrogenase; E3 component of pyruvate and 2-oxoglutarate dehydrogenases complexes; Glycine cleavage system L protein; EC 1.8.1.4 from Escherichia coli (strain K12) (see 2 papers)
34% identity, 98% coverage: 5:440/447 of query aligns to 9:450/474 of P0A9P0
- K220 (≠ S215) modified: N6-acetyllysine
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3ladA Refined crystal structure of lipoamide dehydrogenase from azotobacter vinelandii at 2.2 angstroms resolution. A comparison with the structure of glutathione reductase (see paper)
35% identity, 99% coverage: 2:444/447 of query aligns to 3:459/472 of 3ladA
- active site: L44 (≠ I36), C48 (= C40), C53 (= C45), S56 (≠ T48), V190 (= V180), E194 (= E184), F448 (= F433), H450 (= H435), E455 (= E440)
- binding flavin-adenine dinucleotide: I9 (= I8), G10 (= G9), G12 (= G11), P13 (= P12), E33 (= E32), K34 (= K33), G46 (= G38), T47 (≠ V39), C48 (= C40), G52 (= G44), C53 (= C45), H120 (≠ E111), G121 (≠ A112), A149 (≠ C139), S150 (≠ T140), G151 (= G141), I191 (= I181), R278 (= R264), D318 (= D303), L325 (= L310), A326 (= A311)
P09622 Dihydrolipoyl dehydrogenase, mitochondrial; Dihydrolipoamide dehydrogenase; Glycine cleavage system L protein; EC 1.8.1.4 from Homo sapiens (Human) (see 14 papers)
36% identity, 99% coverage: 1:444/447 of query aligns to 40:496/509 of P09622
- 71:80 (vs. 32:40, 50% identical) binding
- K72 (= K33) to E: in DLDD; reduced dihydrolipoyl dehydrogenase activity; no effect on interaction with PDHX; dbSNP:rs121964987
- K89 (= K49) binding ; mutation to E: Abolishes dihydrolipoyl dehydrogenase activity. Does not affect interaction with PDHX.
- K104 (= K62) to T: in dbSNP:rs1130477
- G154 (= G104) binding
- TGS 183:185 (= TGS 140:142) binding
- 220:227 (vs. 177:184, 75% identical) binding
- E243 (= E200) binding
- V278 (= V234) binding
- G314 (= G263) binding
- D355 (= D303) binding
- MLAH 361:364 (≠ LLAH 309:312) binding
- E375 (≠ N323) to K: in DLDD; loss of enzyme activity; abolished interaction with PDHX; dbSNP:rs121964992
- H383 (≠ R331) mutation to A: Reduces dihydrolipoyl dehydrogenase activity.; mutation to L: Reduces dihydrolipoyl dehydrogenase activity.
- D448 (= D396) Important for interaction with PDHX and activity of multienzyme pyruvate dehydrogenase complex; mutation to A: Reduces interaction with PDHX. Inhibits multienzyme pyruvate dehydrogenase complex activity. Does not affect dihydrolipoyl dehydrogenase activity.; mutation to N: Does not affect dihydrolipoyl dehydrogenase activity.
- E466 (≠ I414) mutation to A: Decreases dehydrogenase activity. Loss of proteolytic activity.
- Y473 (≠ K421) Important for interaction with PDHX and activity of multienzyme pyruvate dehydrogenase complex; mutation to A: Reduces interaction with PDHX. Inhibits multienzyme pyruvate dehydrogenase complex activity. Does not affect dihydrolipoyl dehydrogenase activity.; mutation to F: Does not affect dihydrolipoyl dehydrogenase activity.; mutation to H: Reduces interaction with PDHX. Inhibits multienzyme pyruvate dehydrogenase complex activity. Does not affect dihydrolipoyl dehydrogenase activity.
- D479 (≠ E427) to V: in DLDD; reduced dehydrogenase activity; increased proteolytic activity; dbSNP:rs397514649
- R482 (≠ K430) to G: in DLDD; reduced enzyme activity; dbSNP:rs397514650; mutation to A: Does not affect dihydrolipoyl dehydrogenase activity.; mutation to M: Does not affect interaction with PDHX.
- H485 (≠ F433) mutation to A: Loss of dehydrogenase activity. Increases proteolytic activity.
- P488 (= P436) to L: in DLDD; no effect on interaction with PDHX; dbSNP:rs121964988
- S491 (≠ G439) mutation to A: Loss of proteolytic activity. Does not affect dehydrogenase activity.
- E492 (= E440) mutation to Q: Reduces dihydrolipoyl dehydrogenase activity. Does not affect interaction with PDHX.
- R495 (≠ H443) to G: in DLDD; loss of enzyme activity; reduced interaction with PDHX; dbSNP:rs121964989
Sites not aligning to the query:
- 505 K→M: Reduces dihydrolipoyl dehydrogenase activity. Does not affect interaction with PDHX.
P18925 Dihydrolipoyl dehydrogenase; Dihydrolipoamide dehydrogenase; E3 component of pyruvate complex; EC 1.8.1.4 from Azotobacter vinelandii (see 2 papers)
35% identity, 99% coverage: 2:444/447 of query aligns to 4:460/477 of P18925
- 34:49 (vs. 32:40, 38% identical) binding
- C49 (= C40) modified: Disulfide link with 54, Redox-active
- C54 (= C45) modified: Disulfide link with 49, Redox-active
- K58 (= K49) binding
- D319 (= D303) binding
- A327 (= A311) binding
6hg8B Crystal structure of the r460g disease-causing mutant of the human dihydrolipoamide dehydrogenase.
36% identity, 99% coverage: 1:444/447 of query aligns to 13:469/482 of 6hg8B
- active site: C53 (= C40), C58 (= C45), S61 (≠ T48), V196 (= V180), E200 (= E184), H460 (= H435), E465 (= E440)
- binding flavin-adenine dinucleotide: I20 (= I8), G23 (= G11), P24 (= P12), G25 (≠ A13), E44 (= E32), K45 (= K33), N46 (vs. gap), G51 (= G38), T52 (≠ V39), C53 (= C40), G57 (= G44), C58 (= C45), K62 (= K49), Y126 (= Y103), G127 (= G104), T156 (= T140), G157 (= G141), I197 (= I181), R288 (= R264), F291 (≠ N267), G327 (= G302), D328 (= D303), M334 (≠ L309), L335 (= L310), A336 (= A311), H337 (= H312)
1zmdA Crystal structure of human dihydrolipoamide dehydrogenase complexed to nadh (see paper)
36% identity, 99% coverage: 1:444/447 of query aligns to 3:459/472 of 1zmdA
- active site: L39 (≠ I36), C43 (= C40), C48 (= C45), S51 (≠ T48), V186 (= V180), E190 (= E184), H448 (≠ F433), H450 (= H435), E455 (= E440)
- binding flavin-adenine dinucleotide: I10 (= I8), G11 (= G9), G13 (= G11), P14 (= P12), G15 (≠ A13), E34 (= E32), K35 (= K33), N36 (vs. gap), G41 (= G38), T42 (≠ V39), C43 (= C40), G47 (= G44), C48 (= C45), K52 (= K49), Y116 (= Y103), G117 (= G104), T146 (= T140), G147 (= G141), S166 (= S160), R278 (= R264), F281 (≠ N267), G317 (= G302), D318 (= D303), M324 (≠ L309), L325 (= L310), A326 (= A311), H327 (= H312)
- binding 1,4-dihydronicotinamide adenine dinucleotide: I182 (= I176), G183 (= G177), G185 (= G179), V186 (= V180), I187 (= I181), E190 (= E184), E206 (= E200), F207 (≠ M201), L208 (≠ M202), I276 (≠ V262), G277 (= G263), R278 (= R264), M324 (≠ L309), L325 (= L310), V355 (= V340), Y357 (= Y342)
1zmcA Crystal structure of human dihydrolipoamide dehydrogenase complexed to NAD+ (see paper)
36% identity, 99% coverage: 1:444/447 of query aligns to 3:459/472 of 1zmcA
- active site: L39 (≠ I36), C43 (= C40), C48 (= C45), S51 (≠ T48), V186 (= V180), E190 (= E184), H448 (≠ F433), H450 (= H435), E455 (= E440)
- binding flavin-adenine dinucleotide: I10 (= I8), G11 (= G9), G13 (= G11), P14 (= P12), G15 (≠ A13), E34 (= E32), K35 (= K33), N36 (vs. gap), G41 (= G38), T42 (≠ V39), C43 (= C40), G47 (= G44), C48 (= C45), K52 (= K49), Y116 (= Y103), G117 (= G104), T146 (= T140), G147 (= G141), S166 (= S160), I187 (= I181), F281 (≠ N267), G317 (= G302), D318 (= D303), M324 (≠ L309), L325 (= L310), A326 (= A311), H327 (= H312)
- binding nicotinamide-adenine-dinucleotide: G183 (= G177), G185 (= G179), V205 (= V199), E206 (= E200), F207 (≠ M201), L208 (≠ M202), K240 (= K233), V241 (= V234), I276 (≠ V262), G277 (= G263), R278 (= R264), R297 (= R282), M324 (≠ L309)
P14218 Dihydrolipoyl dehydrogenase; Dihydrolipoamide dehydrogenase; E3 component of 2-oxoglutarate dehydrogenase complex; EC 1.8.1.4 from Pseudomonas fluorescens (see 2 papers)
36% identity, 99% coverage: 1:444/447 of query aligns to 3:460/478 of P14218
- 34:49 (vs. 32:40, 38% identical) binding
- C49 (= C40) modified: Disulfide link with 54, Redox-active
- C54 (= C45) modified: Disulfide link with 49, Redox-active
- K58 (= K49) binding
- G122 (≠ A112) binding
- D319 (= D303) binding
- A327 (= A311) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
5u8vA Dihydrolipoamide dehydrogenase (lpdg) from pseudomonas aeruginosa bound to NAD+ (see paper)
35% identity, 99% coverage: 1:444/447 of query aligns to 1:458/472 of 5u8vA
- active site: P12 (= P12), L43 (≠ I36), C47 (= C40), C52 (= C45), S55 (≠ T48), G81 (≠ S73), V82 (≠ P74), V189 (= V180), E193 (= E184), S329 (≠ I315), F447 (= F433), H449 (= H435), E454 (= E440)
- binding flavin-adenine dinucleotide: I8 (= I8), G11 (= G11), P12 (= P12), G13 (≠ A13), E32 (= E32), G45 (= G38), T46 (≠ V39), C47 (= C40), G51 (= G44), C52 (= C45), K56 (= K49), H119 (≠ E111), G120 (≠ A112), A148 (≠ C139), S149 (≠ T140), G150 (= G141), S169 (= S160), I190 (= I181), R277 (= R264), G316 (= G302), D317 (= D303), M323 (≠ L309), L324 (= L310), A325 (= A311), H326 (= H312), H449 (= H435), P450 (= P436)
- binding nicotinamide-adenine-dinucleotide: I185 (= I176), G186 (= G177), G188 (= G179), V189 (= V180), I190 (= I181), L208 (≠ V199), E209 (= E200), A210 (≠ M201), V243 (= V234), V275 (= V262), G276 (= G263)
Sites not aligning to the query:
5u8wA Dihydrolipoamide dehydrogenase (lpdg) from pseudomonas aeruginosa bound to nadh (see paper)
35% identity, 99% coverage: 1:444/447 of query aligns to 2:459/473 of 5u8wA
- active site: P13 (= P12), L44 (≠ I36), C48 (= C40), C53 (= C45), S56 (≠ T48), G82 (≠ S73), V83 (≠ P74), V190 (= V180), E194 (= E184), S330 (≠ I315), F448 (= F433), H450 (= H435), E455 (= E440)
- binding flavin-adenine dinucleotide: I9 (= I8), G12 (= G11), P13 (= P12), G14 (≠ A13), E33 (= E32), K34 (= K33), G46 (= G38), T47 (≠ V39), C48 (= C40), G52 (= G44), C53 (= C45), K57 (= K49), H120 (≠ E111), G121 (≠ A112), A149 (≠ C139), S150 (≠ T140), G151 (= G141), S170 (= S160), G317 (= G302), D318 (= D303), M324 (≠ L309), L325 (= L310), A326 (= A311), H327 (= H312), Y357 (= Y342), H450 (= H435), P451 (= P436)
- binding 1,4-dihydronicotinamide adenine dinucleotide: I186 (= I176), G189 (= G179), V190 (= V180), I191 (= I181), E194 (= E184), E210 (= E200), A211 (≠ M201), L212 (≠ M202), A275 (≠ S261), V276 (= V262), G277 (= G263), R278 (= R264), M324 (≠ L309), L325 (= L310), V355 (= V340), Y357 (= Y342)
Sites not aligning to the query:
5u8uD Dihydrolipoamide dehydrogenase (lpdg) from pseudomonas aeruginosa (see paper)
36% identity, 99% coverage: 2:444/447 of query aligns to 6:462/477 of 5u8uD
- active site: P16 (= P12), L47 (≠ I36), C51 (= C40), C56 (= C45), S59 (≠ T48), G85 (≠ S73), V86 (≠ P74), V193 (= V180), E197 (= E184), S333 (≠ I315), F451 (= F433), H453 (= H435), E458 (= E440)
- binding flavin-adenine dinucleotide: I12 (= I8), G15 (= G11), P16 (= P12), G17 (≠ A13), E36 (= E32), K37 (= K33), G49 (= G38), T50 (≠ V39), C51 (= C40), G55 (= G44), C56 (= C45), K60 (= K49), H123 (≠ E111), G124 (≠ A112), A152 (≠ C139), S153 (≠ T140), G154 (= G141), I194 (= I181), R281 (= R264), G320 (= G302), D321 (= D303), M327 (≠ L309), L328 (= L310), A329 (= A311), H330 (= H312), H453 (= H435), P454 (= P436)
Sites not aligning to the query:
Query Sequence
>349837 FitnessBrowser__Btheta:349837
MNFDIAIIGGGPAGYTAAERAGANGLRAVLFEKKAIGGVCLNEGCIPTKTLLYSAKILDS
IKSASKYGISAESPSFDLTKIMSRKEKTVKMLTGGVKMTVNSYGVTIVEKEAFIEGEENG
LIRIICDGERYEVKYLLVCTGSDTVIPPIPGLSEVSYWTSKEALEIKELPETLVVIGGGV
IGMEFASFFNSMGVKVHVVEMMPEILGVMDKETSSMLRMEYAKRGVTFYLNTKVIEVKPD
GVVIEKDGKASTIKTEKILLSVGRKANITNVGLDKLNIELHRNGVKVDEYLQTSHPGVYA
CGDITGYSLLAHTAIREAEVAINHILGVEDRMNYNSVPGVVYTNPEVAGVGKTEEELTKQ
GIPYRVTKLPMAYSGRFVAENEQVNGICKLILDEADHIIGCHMLGNPASELIVIAGIAIQ
KGYTVEEFQKNVFPHPTVGEIYHEVLS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory