Comparing 349840 FitnessBrowser__Btheta:349840 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1qs0B Crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b) (see paper)
40% identity, 48% coverage: 352:677/678 of query aligns to 7:337/338 of 1qs0B
1umdD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate (see paper)
38% identity, 48% coverage: 352:678/678 of query aligns to 5:323/323 of 1umdD
1umcD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methylpentanoate (see paper)
38% identity, 48% coverage: 352:678/678 of query aligns to 5:323/323 of 1umcD
1umbD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in holo-form (see paper)
38% identity, 48% coverage: 352:678/678 of query aligns to 5:323/323 of 1umbD
Q5SLR3 2-oxoisovalerate dehydrogenase subunit beta; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDH E1-beta; EC 1.2.4.4 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
38% identity, 48% coverage: 352:678/678 of query aligns to 6:324/324 of Q5SLR3
P21953 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDE1B; BCKDH E1-beta; EC 1.2.4.4 from Homo sapiens (Human) (see 2 papers)
34% identity, 51% coverage: 330:678/678 of query aligns to 58:392/392 of P21953
3dv0D Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
37% identity, 48% coverage: 352:678/678 of query aligns to 5:324/324 of 3dv0D
3dv0B Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
37% identity, 48% coverage: 352:678/678 of query aligns to 5:324/324 of 3dv0B
3dufD Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
37% identity, 48% coverage: 352:678/678 of query aligns to 5:324/324 of 3dufD
1w85B The crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2 (see paper)
37% identity, 48% coverage: 352:678/678 of query aligns to 5:324/324 of 1w85B
2j9fD Human branched-chain alpha-ketoacid dehydrogenase-decarboxylase e1b (see paper)
34% identity, 49% coverage: 346:678/678 of query aligns to 4:329/329 of 2j9fD
1dtwB Human branched-chain alpha-keto acid dehydrogenase (see paper)
34% identity, 49% coverage: 346:678/678 of query aligns to 1:326/326 of 1dtwB
1umdA Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate (see paper)
32% identity, 40% coverage: 13:284/678 of query aligns to 31:299/362 of 1umdA
1umcA Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methylpentanoate (see paper)
32% identity, 40% coverage: 13:284/678 of query aligns to 31:299/362 of 1umcA
1umbA Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in holo-form (see paper)
32% identity, 40% coverage: 13:284/678 of query aligns to 31:299/362 of 1umbA
Q5SLR4 2-oxoisovalerate dehydrogenase subunit alpha; Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain; BCKDH E1-alpha; EC 1.2.4.4 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
32% identity, 40% coverage: 13:284/678 of query aligns to 36:304/367 of Q5SLR4
6cfoB Human pyruvate dehydrogenase e1 component complex with covalent tdp adduct acetyl phosphinate (see paper)
30% identity, 48% coverage: 354:676/678 of query aligns to 8:328/330 of 6cfoB
6cerD Human pyruvate dehydrogenase complex e1 component v138m mutation (see paper)
30% identity, 48% coverage: 354:676/678 of query aligns to 9:329/331 of 6cerD
P11177 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial; PDHE1-B; EC 1.2.4.1 from Homo sapiens (Human) (see 6 papers)
30% identity, 48% coverage: 354:676/678 of query aligns to 37:357/359 of P11177
Sites not aligning to the query:
P11960 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial; Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain; BCKDE1A; BCKDH E1-alpha; EC 1.2.4.4 from Rattus norvegicus (Rat) (see paper)
31% identity, 48% coverage: 13:340/678 of query aligns to 96:421/441 of P11960
>349840 FitnessBrowser__Btheta:349840
MKKKYDIKTTDVETLKKWYHLMTLGRALDEKAPSYQLQSLGWSYHAPYAGHDGIQLAVGQ
VFTLGEDFLFPYYRDMLTVLSAGMTAEEIILNGISKATDPGSGGRHMSNHFAKPEWHIEN
ISSATGTHDLHAAGVARAMVYYGHKGVAITSHGESATSEGFVYEAINGASLERLPVIFVI
QDNGYGISVPKSEQTANRKVAENFSGFKNLKIIYCNGKDVFDSMNAMTEAREYAISTRNP
VIVQANCVRIGSHSNSDKHTLYRDENELEYVKEADPLMKFRRMLLRYKRLTEEELLQIEA
ESKKELSAANRKALAAPEPDPKSIYDFVMPEPYQPQKYKEGTHQEEGEKTFLVNAINETL
KAEFRHNPDTFIWGQDVANREKGGVFNVTKGMQQEFGEARVFSAPIAEDYIVGTANGMSR
FDPKIHVVIEGAEFADYFWPAVEQYVECTHEYWRSNGKFAPNITLRLASGGYIGGGLYHS
QNIEGALTTLPGARIVCPSFADDAAGLLRTSMRSKGFTLFLEPKALYNSVEAAAVVPEDF
EVPFGKARIRREGTDLSIITYGNTTHFCLHVAEQLEKESGWKVEVIDIRSLIPLDKEAIF
ESVKKTSKALVVHEDKVFSGFGAELAAMIGTDMFRYLDGPVQRVGSTFTPVGFNPILEKE
ILPDEAKIYEAAKKLLEY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory