Comparing 349857 BT0329 ketoisovalerate oxidoreductase subunit vorA (NCBI ptt file) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
6n2oC 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
29% identity, 96% coverage: 5:176/180 of query aligns to 7:178/572 of 6n2oC
Sites not aligning to the query:
6n2oA 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
29% identity, 96% coverage: 5:176/180 of query aligns to 7:178/572 of 6n2oA
Sites not aligning to the query:
6n2nA Crystal structure of 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus (see paper)
29% identity, 96% coverage: 5:176/180 of query aligns to 7:178/572 of 6n2nA
Sites not aligning to the query:
>349857 BT0329 ketoisovalerate oxidoreductase subunit vorA (NCBI ptt file)
MKEEIIIAGFGGQGVLSMGKILAYSGLMEGKEVSWMPAYGPEQRGGTANVTVIVSDDKIS
SPILSKYDTAIILNQPSLEKFESRVKPGGILIYDGYGIINPPTRKDIKVYRIDAMDAANE
MNNAKAFNMIVLGGLLQLRPIVTLENVIKGLKKTLPERHHHLIPMNEEAIKKGMELIHEV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory