SitesBLAST
Comparing 349861 FitnessBrowser__Btheta:349861 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
7plmA Cryoem reconstruction of pyruvate ferredoxin oxidoreductase (pfor) in anaerobic conditions (see paper)
35% identity, 68% coverage: 13:63/75 of query aligns to 662:726/1177 of 7plmA
- binding iron/sulfur cluster: C664 (= C15), I665 (≠ K16), Q666 (≠ G17), C667 (= C18), N668 (= N19), C670 (= C21), C674 (= C25), P675 (= P26), I679 (vs. gap), I708 (≠ W45), C715 (= C52), M716 (≠ N53), G717 (= G54), C718 (= C55), G719 (≠ S56), C721 (= C58), C725 (= C62), P726 (= P63)
Sites not aligning to the query:
- binding calcium ion: 950, 952, 1026, 1028
- binding magnesium ion: 930, 958, 960, 962
- binding iron/sulfur cluster: 458, 657, 659, 731, 732, 781, 782, 785, 787, 810, 962, 1038, 1039
- binding thiamine diphosphate: 27, 28, 29, 63, 787, 808, 809, 810, 839, 929, 930, 931, 960, 961, 962, 963, 964
7bkbL Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) (see paper)
40% identity, 76% coverage: 7:63/75 of query aligns to 3:68/79 of 7bkbL
- binding iron/sulfur cluster: C11 (= C15), T12 (≠ K16), C14 (= C18), N15 (= N19), C17 (= C21), C21 (= C25), P22 (= P26), Y40 (vs. gap), A47 (≠ N42), C57 (= C52), A58 (≠ N53), G59 (= G54), C60 (= C55), G61 (≠ S56), C63 (= C58), C67 (= C62)
Sites not aligning to the query:
2c3uA Crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus, oxygen inhibited form (see paper)
31% identity, 68% coverage: 13:63/75 of query aligns to 686:755/1231 of 2c3uA
- binding iron/sulfur cluster: C688 (= C15), I689 (≠ K16), C691 (= C18), N692 (= N19), C694 (= C21), C698 (= C25), P699 (= P26), A702 (vs. gap), I703 (vs. gap), C744 (= C52), M745 (≠ N53), G746 (= G54), C747 (= C55), G748 (≠ S56), C750 (= C58), C754 (= C62), P755 (= P63)
Sites not aligning to the query:
- active site: 30, 63, 113, 995
- binding 2-(3-{[4-(hydroxyamino)-2-methylpyrimidin-5-yl]methyl}-4-methyl-2,3-dihydro-1,3-thiazol-5-yl)ethyl trihydrogen diphosphate: 28, 29, 63, 87, 816, 837, 839, 868, 869, 961, 962, 963, 964, 992, 993, 994, 995, 996
- binding calcium ion: 982, 984, 1055, 1056, 1058, 1060, 1062
- binding magnesium ion: 962, 990, 992
- binding pyruvic acid: 30, 113, 122, 995
- binding iron/sulfur cluster: 458, 681, 683, 760, 761, 811, 814, 816, 839, 1070, 1071
2c3pA Crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase from desulfovibrio africanus (see paper)
31% identity, 68% coverage: 13:63/75 of query aligns to 686:755/1231 of 2c3pA
- binding iron/sulfur cluster: C688 (= C15), I689 (≠ K16), Q690 (≠ G17), C691 (= C18), N692 (= N19), C694 (= C21), C698 (= C25), P699 (= P26), A702 (vs. gap), I703 (vs. gap), C744 (= C52), M745 (≠ N53), G746 (= G54), C747 (= C55), G748 (≠ S56), C750 (= C58), C754 (= C62), P755 (= P63)
Sites not aligning to the query:
- active site: 30, 63, 113, 995
- binding 1-(2-{(2s,4r,5r)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-[(1s)-1-carboxy-1-hydroxyethyl]-4-methyl-1,3-thiazolidin-5-yl}ethoxy)-1,1,3,3-tetrahydroxy-1lambda~5~-diphosphox-1-en-2-ium 3-oxide: 28, 29, 30, 63, 87, 113, 816, 837, 838, 839, 868, 869, 961, 962, 963, 992, 993, 994, 995, 996
- binding calcium ion: 982, 983, 984, 1055, 1056, 1058, 1060, 1062
- binding magnesium ion: 962, 990, 992
- binding iron/sulfur cluster: 458, 681, 683, 760, 761, 810, 811, 814, 816, 839, 994, 1070, 1071
2c3oA Crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase from desulfovibrio africanus (see paper)
31% identity, 68% coverage: 13:63/75 of query aligns to 686:755/1231 of 2c3oA
- binding iron/sulfur cluster: C688 (= C15), I689 (≠ K16), C691 (= C18), N692 (= N19), C694 (= C21), C698 (= C25), P699 (= P26), A702 (vs. gap), I703 (vs. gap), C744 (= C52), G746 (= G54), C747 (= C55), G748 (≠ S56), N749 (≠ S57), C750 (= C58), C754 (= C62)
Sites not aligning to the query:
- active site: 30, 63, 113, 995
- binding calcium ion: 982, 984, 1056, 1058, 1060
- binding magnesium ion: 962, 990, 992
- binding pyruvic acid: 30, 113, 996
- binding iron/sulfur cluster: 458, 681, 760, 761, 810, 811, 814, 816, 839, 1070, 1071
- binding thiamine diphosphate: 28, 29, 63, 87, 816, 837, 838, 839, 868, 961, 962, 963, 992, 993, 994, 995, 996
1kekA Crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase (see paper)
31% identity, 68% coverage: 13:63/75 of query aligns to 686:755/1231 of 1kekA
- binding iron/sulfur cluster: C688 (= C15), I689 (≠ K16), Q690 (≠ G17), C691 (= C18), N692 (= N19), C694 (= C21), C698 (= C25), P699 (= P26), I703 (vs. gap), I737 (≠ W45), C744 (= C52), M745 (≠ N53), G746 (= G54), C747 (= C55), G748 (≠ S56), C750 (= C58), C754 (= C62), P755 (= P63)
Sites not aligning to the query:
- active site: 30, 63, 113, 995
- binding calcium ion: 982, 984, 1055, 1056, 1058, 1062
- binding 2-acetyl-thiamine diphosphate: 29, 63, 87, 113, 816, 837, 838, 839, 868, 961, 962, 963, 992, 993, 994, 995, 996
- binding magnesium ion: 962, 990, 992
- binding iron/sulfur cluster: 458, 681, 683, 760, 761, 810, 811, 814, 816, 839, 1070, 1071
1b0pA Crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus (see paper)
31% identity, 68% coverage: 13:63/75 of query aligns to 686:755/1231 of 1b0pA
- binding iron/sulfur cluster: C688 (= C15), I689 (≠ K16), Q690 (≠ G17), C691 (= C18), N692 (= N19), C694 (= C21), C698 (= C25), P699 (= P26), A702 (vs. gap), I703 (vs. gap), I737 (≠ W45), C744 (= C52), M745 (≠ N53), C747 (= C55), G748 (≠ S56), C750 (= C58), C754 (= C62), P755 (= P63)
Sites not aligning to the query:
- active site: 30, 63, 113, 995
- binding calcium ion: 982, 984, 1055, 1056, 1058, 1060
- binding magnesium ion: 962, 990, 992
- binding iron/sulfur cluster: 458, 681, 683, 760, 811, 814, 816, 839, 994, 1070, 1071
- binding thiamine diphosphate: 28, 29, 63, 816, 837, 838, 839, 868, 961, 962, 963, 992, 993, 994, 995, 996
P94692 Pyruvate:ferredoxin oxidoreductase; PFOR; POR; Pyruvate synthase; EC 1.2.7.1 from Desulfocurvibacter africanus (Desulfovibrio africanus) (see 3 papers)
31% identity, 68% coverage: 13:63/75 of query aligns to 687:756/1232 of P94692
- C689 (= C15) binding
- C692 (= C18) binding
- C695 (= C21) binding
- C699 (= C25) binding
- C745 (= C52) binding
- C748 (= C55) binding
- C751 (= C58) binding
- C755 (= C62) binding
Sites not aligning to the query:
- 31 binding
- 64 binding
- 114 binding
- 812 binding
- 815 binding
- 817 binding
- 840 binding ; binding
- 962:965 binding
- 963 binding
- 983 binding
- 985 binding
- 991 binding
- 991:996 binding
- 993 binding
- 1056 binding
- 1059 binding
- 1061 binding
- 1063 binding
- 1071 binding
7bkbK Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) (see paper)
34% identity, 96% coverage: 1:72/75 of query aligns to 197:268/386 of 7bkbK
- binding iron/sulfur cluster: C211 (= C15), D212 (≠ K16), C214 (= C18), N215 (= N19), C217 (= C21), C221 (= C25), P222 (= P26), V241 (≠ A44), C248 (≠ T51), C249 (= C52), C251 (= C55), C254 (= C58), C258 (= C62), P259 (= P63), I263 (= I67), V265 (= V69)
Sites not aligning to the query:
- binding iron/sulfur cluster: 36, 37, 39, 42, 46, 47, 51, 77, 78, 79, 80, 81, 83, 87, 92, 119, 124, 125, 127, 130, 134, 139, 173, 174, 175, 176, 179, 183, 186, 273, 280, 281, 284, 286, 287, 291, 322, 323, 324, 325, 326, 328, 332, 333
2fjaB Adenosine 5'-phosphosulfate reductase in complex with substrate (see paper)
39% identity, 81% coverage: 9:69/75 of query aligns to 3:63/149 of 2fjaB
- active site: W47 (≠ N53)
- binding iron/sulfur cluster: C9 (= C15), D10 (≠ K16), G11 (= G17), C12 (= C18), T18 (≠ N19), A19 (≠ L20), C20 (= C21), C24 (= C25), L28 (≠ V29), M29 (≠ I30), C46 (= C52), W47 (≠ N53), E48 (≠ G54), C49 (= C55), Y50 (≠ S56), C52 (= C58), C56 (= C62), P57 (= P63), I61 (= I67)
Sites not aligning to the query:
Query Sequence
>349861 FitnessBrowser__Btheta:349861
MAKIKGAIVVDTERCKGCNLCVVACPLDVIALNKEVNMKGYNYAWQVKEDTCNGCSSCAM
VCPDGCISVYKVKVE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory