SitesBLAST
Comparing 349906 FitnessBrowser__Btheta:349906 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5bjuA X-ray structure of the pglf dehydratase from campylobacter jejuni in complex with udp and NAD(h) (see paper)
45% identity, 56% coverage: 274:629/641 of query aligns to 2:337/340 of 5bjuA
- binding nicotinamide-adenine-dinucleotide: G31 (= G303), G34 (= G306), T35 (≠ S307), I36 (= I308), D56 (= D328), H57 (≠ S329), S82 (≠ D356), I83 (≠ V357), A104 (= A378), A105 (= A379), A106 (= A380), K108 (= K382), N123 (≠ V397), I146 (≠ V420), K162 (= K436), F184 (= F466), G185 (= G467), N186 (= N468), V187 (= V469), S190 (= S472), S191 (≠ N473)
- binding uridine-5'-diphosphate: K150 (= K424), N186 (= N468), S193 (= S475), V194 (= V476), T209 (= T491), L210 (≠ V492), T211 (= T493), I215 (= I497), R217 (= R499), E279 (= E564)
5bjvA X-ray structure of the pglf udp-n-acetylglucosamine 4,6-dehydratase from campylobacterjejuni, d396n/k397a variant in complex with udp-n- acrtylglucosamine (see paper)
44% identity, 56% coverage: 274:629/641 of query aligns to 2:337/339 of 5bjvA
- binding nicotinamide-adenine-dinucleotide: G31 (= G303), G34 (= G306), T35 (≠ S307), I36 (= I308), D56 (= D328), H57 (≠ S329), S82 (≠ D356), I83 (≠ V357), A104 (= A378), A105 (= A379), A106 (= A380), K108 (= K382), N123 (≠ V397), I146 (≠ V420), K162 (= K436), F184 (= F466), G185 (= G467), N186 (= N468), V187 (= V469), S190 (= S472), S191 (≠ N473)
- binding uridine-diphosphate-n-acetylglucosamine: K108 (= K382), H109 (= H383), T148 (= T422), G185 (= G467), N186 (= N468), S193 (= S475), V194 (= V476), T209 (= T491), L210 (≠ V492), T211 (= T493), I215 (= I497), R217 (= R499), R276 (= R561), E279 (= E564)
6bwcC X-ray structure of pen from bacillus thuringiensis (see paper)
36% identity, 44% coverage: 294:576/641 of query aligns to 3:277/327 of 6bwcC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G303), T14 (≠ A305), G15 (= G306), T16 (≠ S307), I17 (= I308), S37 (≠ D328), R38 (≠ S329), S39 (≠ A330), D63 (= D356), I64 (≠ V357), V83 (≠ A378), A84 (= A379), K87 (= K382), T125 (≠ V420), S127 (≠ T422), Y137 (≠ M432), K141 (= K436), F167 (= F466), V170 (= V469), S173 (= S472), R174 (≠ N473)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K382), H88 (= H383), S127 (≠ T422), N128 (≠ D423), Y137 (≠ M432), N169 (= N468), S176 (= S475), V177 (= V476), L180 (≠ R479), T192 (= T491), T194 (= T493), M198 (≠ I497), R200 (= R499), L234 (≠ I534), E265 (= E564)
4j2oC Crystal structure of NADP-bound wbjb from a. Baumannii community strain d1279779 (see paper)
37% identity, 44% coverage: 294:575/641 of query aligns to 2:269/316 of 4j2oC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G303), T13 (≠ A305), G14 (= G306), S15 (= S307), F16 (≠ I308), S36 (≠ D328), R37 (≠ S329), D38 (≠ A330), K41 (≠ P333), D60 (= D356), V61 (= V357), A80 (= A378), A81 (= A379), A82 (= A380), K84 (= K382), T99 (≠ V397), L122 (≠ V420), K138 (= K436), Y164 (≠ F466)
4g5hA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with by-product (see paper)
36% identity, 44% coverage: 294:575/641 of query aligns to 11:277/346 of 4g5hA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G303), T22 (≠ A305), G23 (= G306), S24 (= S307), F25 (≠ I308), S45 (≠ D328), R46 (≠ S329), D47 (≠ A330), K50 (≠ P333), D69 (= D356), V70 (= V357), A89 (= A378), A90 (= A379), A91 (= A380), K93 (= K382), L131 (≠ V420), T133 (= T422), K147 (= K436), Y173 (≠ F466)
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: Q94 (≠ H383), V95 (= V384), K135 (= K424), N175 (= N468), S182 (= S475), V183 (= V476), L186 (≠ R479), T198 (= T491), T200 (= T493), M204 (≠ I497), V240 (≠ I534), R263 (= R561), E266 (= E564)
Sites not aligning to the query:
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: 278, 313, 314, 315, 316, 320
3w1vA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with inihibitor (see paper)
36% identity, 44% coverage: 294:575/641 of query aligns to 11:277/347 of 3w1vA
- binding [(2R,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,4-bis(oxidanyl)oxan-2-yl]methylimino-azanylidene-azanium: K93 (= K382), Q94 (≠ H383), N175 (= N468), S179 (= S472), R180 (≠ N473), S182 (= S475), V183 (= V476), L186 (≠ R479), T198 (= T491), I199 (≠ V492), T200 (= T493), M204 (≠ I497), R206 (= R499), V240 (≠ I534), R263 (= R561), E266 (= E564)
3vvcA Crystal structure of capsular polysaccharide synthesizing enzyme cape , k126e, in apo form (see paper)
36% identity, 44% coverage: 294:575/641 of query aligns to 3:269/318 of 3vvcA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G303), T14 (≠ A305), G15 (= G306), F17 (≠ I308), S37 (≠ D328), R38 (≠ S329), D39 (≠ A330), K42 (≠ P333), D61 (= D356), V62 (= V357), R63 (= R358), A81 (= A378), A82 (= A379), A83 (= A380), K85 (= K382), S124 (= S421), T125 (= T422), K139 (= K436), Y165 (≠ F466), G166 (= G467)
2gn8A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp (see paper)
35% identity, 45% coverage: 296:581/641 of query aligns to 4:272/327 of 2gn8A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G303), T13 (≠ A305), G14 (= G306), S15 (= S307), F16 (≠ I308), S37 (≠ D328), R38 (≠ S329), D39 (≠ A330), K42 (≠ P333), D61 (= D356), V62 (= V357), A81 (= A378), A82 (= A379), A83 (= A380), K85 (= K382), T100 (≠ V397), L123 (≠ V420), S124 (= S421), K139 (= K436), Y165 (≠ F466), G166 (= G467), V168 (= V469), S171 (= S472), R172 (≠ N473)
- binding uridine-5'-diphosphate: K127 (= K424), N167 (= N468), V175 (= V476), P191 (≠ T491), I192 (≠ V492), T193 (= T493), M197 (≠ I497), R199 (= R499), M233 (≠ I534), R252 (= R561)
2gnaA Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-gal (see paper)
35% identity, 45% coverage: 296:581/641 of query aligns to 6:274/329 of 2gnaA
- binding galactose-uridine-5'-diphosphate: K87 (= K382), S176 (= S475), V177 (= V476), T195 (= T493), M199 (≠ I497), R201 (= R499), M235 (≠ I534), R254 (= R561), E257 (= E564)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G303), T15 (≠ A305), G16 (= G306), S17 (= S307), F18 (≠ I308), S39 (≠ D328), R40 (≠ S329), D41 (≠ A330), K44 (≠ P333), D63 (= D356), V64 (= V357), A83 (= A378), A84 (= A379), A85 (= A380), K87 (= K382), L125 (≠ V420), S126 (= S421), Y137 (≠ M432), K141 (= K436), Y167 (≠ F466), G168 (= G467), V170 (= V469)
2gn9A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glc (see paper)
35% identity, 45% coverage: 296:581/641 of query aligns to 6:274/329 of 2gn9A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G303), T15 (≠ A305), G16 (= G306), S17 (= S307), F18 (≠ I308), R40 (≠ S329), D41 (≠ A330), K44 (≠ P333), D63 (= D356), V64 (= V357), A83 (= A378), A84 (= A379), A85 (= A380), K87 (= K382), L125 (≠ V420), S126 (= S421), K141 (= K436), Y167 (≠ F466), G168 (= G467), V170 (= V469), R174 (≠ N473)
- binding uridine-5'-diphosphate-glucose: K87 (= K382), T127 (= T422), K129 (= K424), Y137 (≠ M432), N169 (= N468), S176 (= S475), V177 (= V476), P193 (≠ T491), T195 (= T493), M199 (≠ I497), R201 (= R499), M235 (≠ I534), R254 (= R561), E257 (= E564)
2gn6A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glcnac (see paper)
35% identity, 45% coverage: 296:581/641 of query aligns to 6:274/329 of 2gn6A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G303), T15 (≠ A305), G16 (= G306), S17 (= S307), F18 (≠ I308), R40 (≠ S329), D41 (≠ A330), K44 (≠ P333), D63 (= D356), V64 (= V357), A84 (= A379), A85 (= A380), K87 (= K382), S126 (= S421), Y137 (≠ M432), K141 (= K436), Y167 (≠ F466), G168 (= G467), V170 (= V469), S173 (= S472), R174 (≠ N473)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K382), D128 (= D423), K129 (= K424), N169 (= N468), G175 (= G474), S176 (= S475), V177 (= V476), P193 (≠ T491), I194 (≠ V492), M199 (≠ I497), R201 (= R499), M235 (≠ I534), R254 (= R561), E257 (= E564)
2gn4A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADPH and udp-glcnac (see paper)
35% identity, 45% coverage: 296:581/641 of query aligns to 6:274/329 of 2gn4A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G303), T15 (≠ A305), G16 (= G306), S17 (= S307), F18 (≠ I308), S39 (≠ D328), R40 (≠ S329), D41 (≠ A330), K44 (≠ P333), D63 (= D356), V64 (= V357), A83 (= A378), A84 (= A379), A85 (= A380), K87 (= K382), T102 (≠ V397), L125 (≠ V420), S126 (= S421), T127 (= T422), Y137 (≠ M432), K141 (= K436), Y167 (≠ F466), G168 (= G467), V170 (= V469), S173 (= S472), R174 (≠ N473)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K382), T127 (= T422), D128 (= D423), K129 (= K424), Y137 (≠ M432), N169 (= N468), S176 (= S475), V177 (= V476), P193 (≠ T491), T195 (= T493), M199 (≠ I497), R201 (= R499), M235 (≠ I534), R254 (= R561), E257 (= E564)
O25511 UDP-N-acetylglucosamine 4,6-dehydratase (inverting); Pseudaminic acid biosynthesis protein B; UDP-GlcNAc-inverting 4,6-dehydratase; EC 4.2.1.115 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
35% identity, 45% coverage: 296:581/641 of query aligns to 10:278/333 of O25511
3pvzA Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
28% identity, 47% coverage: 277:575/641 of query aligns to 5:316/372 of 3pvzA
- binding nicotinamide-adenine-dinucleotide: G40 (= G306), S41 (= S307), I42 (= I308), D62 (= D328), I63 (≠ S329), D92 (= D356), I93 (≠ V357), L114 (≠ A378), S115 (≠ A379), A116 (= A380), K118 (= K382), V158 (= V420), D161 (= D423), K174 (= K436), V198 (= V469), S201 (= S472)
3vvbA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in apo form (see paper)
31% identity, 39% coverage: 294:542/641 of query aligns to 1:214/270 of 3vvbA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G303), T12 (≠ A305), G13 (= G306), S14 (= S307), F15 (≠ I308), S35 (≠ D328), R36 (≠ S329), D37 (≠ A330), K40 (≠ P333), D59 (= D356), V60 (= V357), A80 (= A379), A81 (= A380), K83 (= K382), L121 (≠ V420), T123 (= T422), K137 (= K436), Y163 (≠ F466), G164 (= G467)
4tqgA Crystal structure of megavirus udp-glcnac 4,6-dehydratase, 5-epimerase mg534 (see paper)
27% identity, 45% coverage: 292:579/641 of query aligns to 1:256/297 of 4tqgA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G303), S14 (≠ A305), G15 (= G306), S16 (= S307), L17 (≠ I308), R36 (≠ S329), D37 (≠ A330), D59 (= D356), I60 (≠ V357), A81 (= A378), A82 (= A379), A83 (= A380), K85 (= K382), V128 (= V420), Y140 (≠ M432), K144 (= K436), Y168 (≠ F466), G169 (= G467), V171 (= V469)
3pvzB Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
29% identity, 39% coverage: 277:524/641 of query aligns to 3:236/300 of 3pvzB
- binding nicotinamide-adenine-dinucleotide: G38 (= G306), S39 (= S307), I40 (= I308), D60 (= D328), I61 (≠ S329), L89 (≠ G355), D90 (= D356), I91 (≠ V357), L112 (≠ A378), S113 (≠ A379), A114 (= A380), K116 (= K382), D159 (= D423), K172 (= K436), N195 (= N468), V196 (= V469), S199 (= S472)
6pnlA Structure of epimerase mth375 from the thermophilic pseudomurein- containing methanogen methanothermobacter thermautotrophicus
27% identity, 41% coverage: 290:554/641 of query aligns to 6:288/336 of 6pnlA
- active site: S133 (≠ T422), C135 (vs. gap), G136 (vs. gap), Y159 (≠ M432), K163 (= K436)
- binding nicotinamide-adenine-dinucleotide: G22 (= G303), G25 (= G306), C26 (≠ S307), D46 (≠ H335), N47 (= N336), L48 (≠ V337), S49 (≠ R338), S50 (≠ L339), S51 (≠ E340), D68 (= D356), I69 (≠ V357), L89 (≠ A378), A91 (= A380), F93 (≠ K382), V108 (= V397), S131 (≠ V420), S133 (≠ T422), Y159 (≠ M432), K163 (= K436), F186 (≠ K460), N188 (≠ I462), V189 (≠ T463), R200 (≠ G474)
- binding uridine-5'-diphosphate: N188 (≠ I462), N201 (≠ S475), V202 (= V476), F206 (= F480), P217 (≠ T491), I218 (≠ V492), T219 (= T493), R226 (vs. gap), V262 (= V525), R285 (≠ E551)
6pmhA Structure of epimerase mth375 from the thermophilic pseudomurein- containing methanogen methanothermobacter thermautotrophicus
27% identity, 41% coverage: 294:554/641 of query aligns to 7:282/330 of 6pmhA
- active site: S127 (≠ T422), C129 (vs. gap), G130 (vs. gap), Y153 (≠ M432), K157 (= K436)
- binding adenosine monophosphate: G16 (= G303), G19 (= G306), D40 (≠ H335), N41 (= N336), S43 (≠ R338), S44 (≠ L339), S45 (≠ E340), D62 (= D356), I63 (≠ V357), A84 (= A379), F87 (≠ K382), R194 (≠ G474)
- binding uridine-5'-diphosphate: C129 (vs. gap), N182 (≠ I462), N195 (≠ S475), V196 (= V476), F200 (= F480), P211 (≠ T491), I212 (≠ V492), T213 (= T493), R220 (vs. gap), V256 (= V525), R279 (≠ E551)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
24% identity, 39% coverage: 299:547/641 of query aligns to 3:257/309 of 4zrnA
- active site: T117 (= T422), G119 (≠ K424), A120 (= A425), Y143 (≠ M432), K147 (= K436), Y181 (vs. gap), G185 (≠ S475)
- binding nicotinamide-adenine-dinucleotide: G7 (= G303), G10 (= G306), F11 (≠ S307), I12 (= I308), D31 (≠ F327), N32 (≠ D328), S34 (≠ A330), S35 (≠ E331), G36 (≠ S332), S51 (≠ V353), I52 (= I354), L73 (≠ A378), A74 (= A379), A75 (= A380), T92 (≠ V397), S115 (≠ V420), S116 (= S421), Y143 (≠ M432), K147 (= K436), Y170 (≠ F466), V173 (= V469)
- binding uridine-5'-diphosphate-glucose: T117 (= T422), G119 (≠ K424), A120 (= A425), Y143 (≠ M432), N172 (= N468), G185 (≠ S475), V186 (= V476), H201 (≠ T491), F203 (vs. gap), Y208 (≠ I497), R210 (= R499), V244 (≠ I534)
Sites not aligning to the query:
Query Sequence
>349906 FitnessBrowser__Btheta:349906
MKHAFDRFVQYLQKNYFSYWIVLGIDTFIALICTWVSFIGIHYITETSKEITSLFHILAI
SVISSILGSFLFHTYRNTIRFSQLKELWRLAGSALIKAVCIAMAIWLFLPQTGLHNSQKI
VFVLFDGMLTFIAMVGFRIQLILVYELLLNMLNKKNMHILIYGIDDKSVALKVRLMNSSH
YKVVGFCIYGTGDSIRRVADLPVYSFKDEECFNKLIHKKCIGGILFARYENTREEEDRLL
QYCKRSGLKTLIAPSISEADENGSFHQWVRPIKIEDLLGRSEIHINMEEVMTEFCGKVVL
VTGAAGSIGSELCRQLAQMNIKKLIMFDSAESPLHNVRLEFEKNYPDLDFVPVIGDVRVK
ERLRMVFETYQPQIIFHAAAYKHVPLMEENPCEAVLVNVVGSRQVADMAVEYGAEKMIMV
STDKAVNPTNVMGCSKRLAEIYVQSLGCAIREGKVKGHTKFITTRFGNVLGSNGSVIPRF
KEQIENGGPVTVTHPDIIRFFMTIPEACRLVMEAATMGEGNEIFVFEMGKAVKIVDLATR
MIELAGYRPGEDIEIEFTGLRPGEKLYEEVLSDKENTIPTENKKIMIAKVRHYEYTDILD
TYTEFEKLSRSVQIMDTVKLMKRVVPEFKSKNSPRFEVLDR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory