Comparing 349921 FitnessBrowser__Btheta:349921 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
30% identity, 86% coverage: 26:197/201 of query aligns to 65:243/243 of 4n69A
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
31% identity, 86% coverage: 26:197/201 of query aligns to 61:233/233 of 4n6bA
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
70% identity, 26% coverage: 149:201/201 of query aligns to 133:185/186 of 4isxA
Sites not aligning to the query:
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
29% identity, 82% coverage: 33:197/201 of query aligns to 74:243/243 of 7ra4A
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
29% identity, 82% coverage: 33:197/201 of query aligns to 76:245/261 of 6wyeA
4aawA S.Pneumoniae glmu in complex with an antibacterial inhibitor (see paper)
39% identity, 38% coverage: 116:191/201 of query aligns to 343:434/455 of 4aawA
Sites not aligning to the query:
1hm9A Crystal structure of s.Pneumoniae n-acetylglucosamine-1-phosphate uridyltransferase, glmu, bound to acetyl coenzyme a and udp-n- acetylglucosamine (see paper)
39% identity, 38% coverage: 116:191/201 of query aligns to 346:437/458 of 1hm9A
Sites not aligning to the query:
1hm8A Crystal structure of s.Pneumoniae n-acetylglucosamine-1-phosphate uridyltransferase, glmu, bound to acetyl coenzyme a (see paper)
39% identity, 38% coverage: 116:191/201 of query aligns to 346:437/458 of 1hm8A
Sites not aligning to the query:
4ac3A S.Pneumoniae glmu in complex with an antibacterial inhibitor (see paper)
39% identity, 38% coverage: 116:191/201 of query aligns to 344:435/456 of 4ac3A
Sites not aligning to the query:
7kr9A Bifunctional enzyme glmu bound to zn(ii) (see paper)
39% identity, 38% coverage: 116:191/201 of query aligns to 341:432/453 of 7kr9A
Sites not aligning to the query:
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
41% identity, 39% coverage: 123:201/201 of query aligns to 103:185/190 of 5u2kA
Sites not aligning to the query:
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
60% identity, 26% coverage: 149:200/201 of query aligns to 133:184/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
60% identity, 26% coverage: 149:200/201 of query aligns to 133:184/201 of 1kruA
Sites not aligning to the query:
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
60% identity, 26% coverage: 149:200/201 of query aligns to 134:185/203 of P07464
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
60% identity, 26% coverage: 149:200/201 of query aligns to 133:184/200 of 1krrA
Sites not aligning to the query:
Q97R46 Bifunctional protein GlmU; EC 2.7.7.23; EC 2.3.1.157 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see 2 papers)
38% identity, 38% coverage: 116:191/201 of query aligns to 347:438/459 of Q97R46
Sites not aligning to the query:
1g97A S.Pneumoniae glmu complexed with udp-n-acetylglucosamine and mg2+ (see paper)
38% identity, 38% coverage: 116:191/201 of query aligns to 346:437/446 of 1g97A
Sites not aligning to the query:
4mzuB Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
36% identity, 29% coverage: 143:201/201 of query aligns to 81:144/290 of 4mzuB
Sites not aligning to the query:
4mzuF Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
35% identity, 29% coverage: 143:201/201 of query aligns to 81:145/294 of 4mzuF
Sites not aligning to the query:
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
42% identity, 37% coverage: 127:201/201 of query aligns to 112:187/188 of 3igjC
Sites not aligning to the query:
>349921 FitnessBrowser__Btheta:349921
MNKRKIRDIGRLTFSLLFFGLYIPHIFLYLFKNSLRKSINADLERRKEKNEVRMNKCLMF
LYYIHTDRYFRNLFYHRVGAVVGALIGWWRLGDRSFVISKTTKIGEGAYFAHPFACEINA
KSIGKNFSCRHLTTLGNKADGDNDNRPVIGDNVTLGVNVTIIGGVIVGNNVIIGAGSVVV
KDIPDNSVAVGNPCRVIKTIE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory