Comparing 349961 FitnessBrowser__Btheta:349961 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1z05A Crystal structure of the rok family transcriptional regulator, homolog of e.Coli mlc protein.
28% identity, 90% coverage: 36:397/402 of query aligns to 25:383/396 of 1z05A
P50456 DNA-binding transcriptional repressor Mlc; Making large colonies protein; Membrane linked control from Escherichia coli (strain K12) (see 4 papers)
25% identity, 89% coverage: 36:394/402 of query aligns to 35:390/406 of P50456
1z6rA Crystal structure of mlc from escherichia coli (see paper)
25% identity, 89% coverage: 36:394/402 of query aligns to 24:366/382 of 1z6rA
5f7qE Rok repressor lmo0178 from listeria monocytogenes bound to operator (see paper)
26% identity, 93% coverage: 30:401/402 of query aligns to 27:391/396 of 5f7qE
Sites not aligning to the query:
3vglA Crystal structure of a rok family glucokinase from streptomyces griseus in complex with glucose and amppnp (see paper)
28% identity, 78% coverage: 85:396/402 of query aligns to 1:310/312 of 3vglA
3vgkB Crystal structure of a rok family glucokinase from streptomyces griseus (see paper)
28% identity, 78% coverage: 85:396/402 of query aligns to 1:310/312 of 3vgkB
2qm1B Crystal structure of glucokinase from enterococcus faecalis
27% identity, 77% coverage: 88:395/402 of query aligns to 9:319/325 of 2qm1B
5f7rA Rok repressor lmo0178 from listeria monocytogenes bound to inducer (see paper)
27% identity, 79% coverage: 85:400/402 of query aligns to 1:306/306 of 5f7rA
6jdbA Crystal structure of n-acetyl mannosmaine kinase in complex with mannac-6p and adp from haemophilus influenzae
27% identity, 73% coverage: 109:400/402 of query aligns to 22:290/290 of 6jdbA
Sites not aligning to the query:
6jdcA Crystal structure of n-acetyl mannosmaine kinase in complex with mannac from haemophilus influenzae
31% identity, 43% coverage: 109:279/402 of query aligns to 23:195/269 of 6jdcA
4db3A 1.95 angstrom resolution crystal structure of n-acetyl-d-glucosamine kinase from vibrio vulnificus.
29% identity, 55% coverage: 174:394/402 of query aligns to 94:307/311 of 4db3A
6jdoA Crystal structure of n-acetyl mannosmaine kinase with amp-pnp from pasteurella multocida
25% identity, 51% coverage: 150:355/402 of query aligns to 66:250/293 of 6jdoA
6jdhA Crystal structure of n-acetyl mannosmaine kinase from pasteurella multocida
25% identity, 51% coverage: 150:355/402 of query aligns to 66:250/293 of 6jdhA
7p9lAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
27% identity, 53% coverage: 180:394/402 of query aligns to 93:301/303 of 7p9lAAA
Sites not aligning to the query:
7p9pAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
27% identity, 53% coverage: 180:394/402 of query aligns to 94:302/304 of 7p9pAAA
Sites not aligning to the query:
7p7wBBB Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
27% identity, 53% coverage: 180:394/402 of query aligns to 96:304/306 of 7p7wBBB
P32718 D-allose kinase; Allokinase; EC 2.7.1.55 from Escherichia coli (strain K12) (see paper)
24% identity, 56% coverage: 176:400/402 of query aligns to 98:301/309 of P32718
Sites not aligning to the query:
2yhwA High-resolution crystal structures of n-acetylmannosamine kinase: insights about substrate specificity, activity and inhibitor modelling. (see paper)
25% identity, 70% coverage: 88:368/402 of query aligns to 6:280/309 of 2yhwA
3vovB Crystal structure of rok hexokinase from thermus thermophilus (see paper)
27% identity, 55% coverage: 175:395/402 of query aligns to 87:291/298 of 3vovB
O35826 Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase; UDP-GlcNAc-2-epimerase/ManAc kinase; EC 3.2.1.183; EC 2.7.1.60 from Rattus norvegicus (Rat) (see paper)
23% identity, 70% coverage: 88:368/402 of query aligns to 410:688/722 of O35826
Sites not aligning to the query:
>349961 FitnessBrowser__Btheta:349961
MNQQFLKEIEMGSKNALVKKRIITHYIYNGSSTIPDLSKELDLSVPTVTKFIGEMCEDGY
INDYGKLETSGGRHPNLYGLNPESGYFIGVDIKRFAVNIGLINFKGDMVELKMNIPYKFE
NSIEGMNELCKLILNFIKKLPINKEKILNINVNVSGWVNPESGYSFSQFNFEERPLADVL
SEKLGHKVTIDNDTRAMTYGEYMQGCVKGEKDIIFVNVSWGVGIGIIIDGKVYTGKSGFS
GEFGHVNAYDNEIICHCGKKGCLETEASGSALHRILLERIKSGESSILSTRISGEEDPIT
LDEIITAVNKEDLLCIEIVEEIGQKLGKQIAGLINIFNPELVIIGGTLSLTGDYITQPIK
TAVRKYSLNLVNKDSAIITSKLKDKAGIVGACMLARSRMFES
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory