Comparing 349989 FitnessBrowser__Btheta:349989 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5t99A Crystal structure of bugh2awt in complex with galactoisofagomine (see paper)
45% identity, 97% coverage: 22:831/839 of query aligns to 2:753/757 of 5t99A
7cwdA Crystal structure of beta-galactosidase ii from bacillus circulans in complex with beta-d-galactopyranosyl disaccharide (see paper)
39% identity, 96% coverage: 30:831/839 of query aligns to 6:799/803 of 7cwdA
7nitD X-ray structure of a multidomain bbgiii from bifidobacterium bifidum (see paper)
34% identity, 98% coverage: 13:834/839 of query aligns to 14:872/1253 of 7nitD
Sites not aligning to the query:
5dmyA Beta-galactosidase - construct 33-930
34% identity, 98% coverage: 16:834/839 of query aligns to 1:852/855 of 5dmyA
6qubA Truncated beta-galactosidase iii from bifidobacterium bifidum in complex with galactose
34% identity, 97% coverage: 18:834/839 of query aligns to 1:854/857 of 6qubA
4cu8A Unravelling the multiple functions of the architecturally intricate streptococcus pneumoniae beta-galactosidase, bgaa (see paper)
34% identity, 96% coverage: 30:831/839 of query aligns to 18:842/848 of 4cu8A
4cu7A Unravelling the multiple functions of the architecturally intricate streptococcus pneumoniae beta-galactosidase, bgaa (see paper)
34% identity, 96% coverage: 30:831/839 of query aligns to 18:842/848 of 4cu7A
4cucA Unravelling the multiple functions of the architecturally intricate streptococcus pneumoniae beta-galactosidase, bgaa. (see paper)
34% identity, 96% coverage: 30:831/839 of query aligns to 18:842/847 of 4cucA
6qudA 2-deoxy-galactose reaction intermediate of a truncated beta- galactosidase iii from bifidobacterium bifidum
34% identity, 97% coverage: 18:834/839 of query aligns to 1:834/837 of 6qudA
5t9gC Crystal structure of bugh2cwt in complex with galactoisofagomine (see paper)
29% identity, 96% coverage: 30:832/839 of query aligns to 3:809/811 of 5t9gC
6hpdA The structure of a beta-glucuronidase from glycoside hydrolase family 2 (see paper)
24% identity, 97% coverage: 19:834/839 of query aligns to 2:778/955 of 6hpdA
T2KN75 Beta-glucuronidase; Glycosyl hydrolase 2 family protein P17; P17_GH2; Polysaccharide utilization locus H protein P17; PUL H protein P17; EC 3.2.1.31 from Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) (see paper)
24% identity, 97% coverage: 19:834/839 of query aligns to 20:796/981 of T2KN75
6nzgA Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine (see paper)
25% identity, 77% coverage: 25:671/839 of query aligns to 2:644/837 of 6nzgA
6d50B Bacteroides uniforms beta-glucuronidase 2 bound to d-glucaro-1,5- lactone (see paper)
25% identity, 77% coverage: 25:671/839 of query aligns to 2:644/840 of 6d50B
5z1aA The crystal structure of bacteroides fragilis beta-glucuronidase in complex with uronic isofagomine
29% identity, 66% coverage: 117:670/839 of query aligns to 63:622/655 of 5z1aA
8dhlB Tannerella forsythia beta-glucuronidase (l2) (see paper)
27% identity, 70% coverage: 25:614/839 of query aligns to 2:578/853 of 8dhlB
Sites not aligning to the query:
8dhlA Tannerella forsythia beta-glucuronidase (l2) (see paper)
26% identity, 70% coverage: 25:614/839 of query aligns to 3:564/827 of 8dhlA
Sites not aligning to the query:
6mvgA Crystal structure of fmn-binding beta-glucuronidase from ruminococcus gnavus (see paper)
25% identity, 76% coverage: 25:662/839 of query aligns to 1:595/637 of 6mvgA
7kgzB Fmn-binding beta-glucuronidase from roseburia hominis (see paper)
24% identity, 77% coverage: 24:665/839 of query aligns to 1:591/634 of 7kgzB
6mvfA Crystal structure of fmn-binding beta-glucuronidase from facaelibacterium prausnitzii l2-6 (see paper)
26% identity, 68% coverage: 104:675/839 of query aligns to 50:611/643 of 6mvfA
>349989 FitnessBrowser__Btheta:349989
MTINIRYLLGIALLFSFSVISAQVRTSYTFEKGWKFTREDNADFIQPDYNDIKWQSVVVP
HDWAIYGPFGIDNDRQLTAIAQDGQKEAMEHAGRTGGLPFVGVGWYRLNFDAPSFVKGKK
ATLIFDGAMSHARVYINGQEAGYWPYGYNTFYLDVTPYLKEGTKNTLAVRLENETESSRW
YPGAGLYRNVHLVVTEDAHIPTWGTQLTTPVVKDDYAKVNIKTTLVVPSGKQFDAYRIVT
ELKDKDGKVVTTDEKQGSRFDDNIFSQELVVSRPALWSPETPVLYQAVSKVYEGNILKDE
YTTSFGIRTIEVIPNKGFFLNGKRTSFKGVCNHHDLGPLGGAVNDAAIRRQIRILKDMGC
NAIRTSHNMPAPELIRACDEMGMMVMAESFDEWKAMKVKNGYRHVFDEWAVKDLTNLLRH
YRNNPSVVMWCIGNEVPEQWDGNKGPKMSYFLQELCHREDPTRPVTQGMDAPDAVVNNNM
AAVMDIAGFNYRPHKYQENYKKLPQQIVLGSETASTVSSRGVYKFPVTRQWMKKYDDHQS
SSYDVESCSWSNLPEDDFIQHEDLPYCIGEFVWTGFDYLGEPTPYYTDWPSHSSLFGIID
LAGLPKDRYYLYRSHWNKEQETLHILPHWNWEGREGEITPVFVYTNYPSAELFINGKSQG
KRTKDLSVTIDNSADSVSIMNLKRQSRYRLMWMDTKYEPGTVKVVAYDADGKAVAEKELH
TAGKPDHIELVADRNVIKADGKDLSFVTVRVVDRDGNLCPDASHEISFKVKGEGSYRAGA
NGNAASLESFQHPKMKVFSGMMTAIVSSTEQPGKITLEATGKGLKKGALIIESCQEAKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory