Comparing 350000 FitnessBrowser__Btheta:350000 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
42% identity, 46% coverage: 124:240/252 of query aligns to 73:188/190 of 5u2kA
3nz2J Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
34% identity, 48% coverage: 114:233/252 of query aligns to 57:181/185 of 3nz2J
Sites not aligning to the query:
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
44% identity, 35% coverage: 147:235/252 of query aligns to 96:184/203 of P07464
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
44% identity, 35% coverage: 147:235/252 of query aligns to 95:183/200 of 1krrA
Sites not aligning to the query:
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
34% identity, 48% coverage: 114:233/252 of query aligns to 54:178/183 of 3nz2C
Sites not aligning to the query:
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
44% identity, 35% coverage: 147:235/252 of query aligns to 95:183/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
44% identity, 35% coverage: 147:235/252 of query aligns to 95:183/201 of 1kruA
Sites not aligning to the query:
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
34% identity, 48% coverage: 114:233/252 of query aligns to 47:171/176 of 3ectA
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
44% identity, 35% coverage: 147:235/252 of query aligns to 95:183/186 of 4isxA
Sites not aligning to the query:
4husA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1 (see paper)
53% identity, 24% coverage: 180:239/252 of query aligns to 110:169/212 of 4husA
Sites not aligning to the query:
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
53% identity, 24% coverage: 180:239/252 of query aligns to 110:169/211 of 4hurA
Sites not aligning to the query:
6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
53% identity, 24% coverage: 180:239/252 of query aligns to 110:169/206 of 6x3jA
Sites not aligning to the query:
6x3cA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
53% identity, 24% coverage: 180:239/252 of query aligns to 110:169/207 of 6x3cA
Sites not aligning to the query:
6x3cE Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
53% identity, 24% coverage: 180:239/252 of query aligns to 110:169/203 of 6x3cE
Sites not aligning to the query:
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
41% identity, 35% coverage: 147:233/252 of query aligns to 97:183/188 of 3igjC
Sites not aligning to the query:
4mzuF Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
34% identity, 46% coverage: 117:232/252 of query aligns to 14:140/294 of 4mzuF
Sites not aligning to the query:
3dhoA Structure of streptogramin acetyltransferase in complex with an inhibitor
49% identity, 23% coverage: 180:236/252 of query aligns to 111:167/203 of 3dhoA
Sites not aligning to the query:
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
49% identity, 23% coverage: 180:236/252 of query aligns to 111:167/204 of 1mrlA
Sites not aligning to the query:
1khrA Crystal structure of vat(d) in complex with virginiamycin and coenzyme a (see paper)
49% identity, 23% coverage: 180:236/252 of query aligns to 111:167/206 of 1khrA
Sites not aligning to the query:
1kk4A Crystal structure of vat(d) in complex with acetyl-coa (see paper)
49% identity, 23% coverage: 180:236/252 of query aligns to 111:167/205 of 1kk4A
Sites not aligning to the query:
>350000 FitnessBrowser__Btheta:350000
MNLSVVLFILIVVFIKYWLLLFTSPLLMAYCWLHRRKNMANPEGEVSEIRDSGITSSSCS
KKLFKRIDKRGLINIVDGYFRWMIKIISDIPSHHIRDFFYKYIFLVKMEKNSVLYYGSEI
RAPWMLMIGKGSVVGDNSILDARRGGIYIGENVNIASNVSLWTGGHDYNDPYFRSMKTNR
GPIYIKNRVWIGPNVTILHSVTIGEGAVIAAGAVVTKDIPPFTICGGIPAKVLAQRSIDL
RYTLGGTYLHFL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory