Comparing 350016 FitnessBrowser__Btheta:350016 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
2afbA Crystal structure of 2-dehydro-3- deoxygluconokinase (ec 2.7.1.45) (tm0067) from thermotoga maritima at 2.05 a resolution (see paper)
54% identity, 97% coverage: 4:333/341 of query aligns to 7:329/329 of 2afbA
Sites not aligning to the query:
3ktnA Crystal structure of a putative 2-keto-3-deoxygluconate kinase from enterococcus faecalis
28% identity, 95% coverage: 4:327/341 of query aligns to 3:324/340 of 3ktnA
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
37% identity, 59% coverage: 4:205/341 of query aligns to 3:202/309 of Q53W83
Sites not aligning to the query:
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
37% identity, 59% coverage: 4:205/341 of query aligns to 3:202/301 of 1v1aA
Sites not aligning to the query:
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
37% identity, 59% coverage: 4:205/341 of query aligns to 3:202/300 of 1v1bA
Sites not aligning to the query:
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
29% identity, 96% coverage: 4:330/341 of query aligns to 2:304/308 of 2dcnA
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
27% identity, 94% coverage: 5:326/341 of query aligns to 4:302/313 of Q97U29
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
27% identity, 94% coverage: 5:326/341 of query aligns to 3:301/311 of 2varA
8cqxA Ribokinase from t.Sp mutant a92g
24% identity, 93% coverage: 14:330/341 of query aligns to 18:297/300 of 8cqxA
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
20% identity, 84% coverage: 5:292/341 of query aligns to 3:256/304 of 3ih0A
Sites not aligning to the query:
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
20% identity, 84% coverage: 5:292/341 of query aligns to 2:255/302 of 3gbuA
Sites not aligning to the query:
>350016 FitnessBrowser__Btheta:350016
MGKKVVTLGEIMLRLSTPGNTRFVQSDSFDVVYGGGEANVAVSCANYGHEAYFVTKLPKH
EIGQSAVNALRKYGVKTDFIARGGDRVGIYYLETGASMRPSKVIYDRAHSAIAEADAADF
DFDAIMEGADWFHWSGITPAISDKAAELTRLACEAAKRHGVTVSVDLNFRKKLWTKEKAQ
SIMKPLMKYVDVCIGNEEDAELCLGFKPDADVEAGHTDAEGYKGIFQQMMKEFGFKYVVS
TLRESFSATHNGWKAMIYNGEEFYTSKRYDIDPIIDRVGGGDSFSGGIIHGLMTKPNQGA
ALEFAVAASALKHTINGDFNLVSVEEVEALAGGDASGRVQR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory