Comparing 350017 FitnessBrowser__Btheta:350017 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
1wa3D Mechanism of the class i kdpg aldolase (see paper)
34% identity, 78% coverage: 18:192/223 of query aligns to 11:180/203 of 1wa3D
1euaA Schiff base intermediate in kdpg aldolase from escherichia coli (see paper)
29% identity, 84% coverage: 28:214/223 of query aligns to 27:208/213 of 1euaA
P0A955 KHG/KDPG aldolase; EC 4.1.3.16; EC 4.1.2.14 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 84% coverage: 28:214/223 of query aligns to 27:208/213 of P0A955
1wauA Structure of kdpg aldolase e45n mutant (see paper)
29% identity, 84% coverage: 28:214/223 of query aligns to 27:208/213 of 1wauA
2c0aB Mechanism of the class i kdpg aldolase (see paper)
29% identity, 84% coverage: 28:214/223 of query aligns to 28:209/214 of 2c0aB
Sites not aligning to the query:
Q6BF16 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; 2-oxo-3-deoxygalactonate 6-phosphate aldolase; 6-phospho-2-dehydro-3-deoxygalactonate aldolase; 6-phospho-2-keto-3-deoxygalactonate aldolase; KDPGal; EC 4.1.2.21 from Escherichia coli (strain K12) (see paper)
32% identity, 72% coverage: 34:193/223 of query aligns to 25:180/205 of Q6BF16
Sites not aligning to the query:
2v82A Kdpgal complexed to kdpgal (see paper)
32% identity, 72% coverage: 34:193/223 of query aligns to 24:179/205 of 2v82A
Sites not aligning to the query:
3vcrA Crystal structure of a putative kdpg (2-keto-3-deoxy-6- phosphogluconate) aldolase from oleispira antarctica (see paper)
28% identity, 87% coverage: 18:212/223 of query aligns to 14:209/216 of 3vcrA
6oviA Crystal structure of kdpg aldolase from legionella pneumophila with pyruvate captured at low ph as a covalent carbinolamine intermediate
26% identity, 88% coverage: 15:210/223 of query aligns to 11:201/210 of 6oviA
P00885 2-dehydro-3-deoxy-phosphogluconate aldolase; KDPG-aldolase; Phospho-2-dehydro-3-deoxygluconate aldolase; Phospho-2-keto-3-deoxygluconate aldolase; EC 4.1.2.14 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
25% identity, 97% coverage: 1:217/223 of query aligns to 11:223/226 of P00885
Sites not aligning to the query:
1mxsA Crystal structure of 2-keto-3-deoxy-6-phosphogluconate (kdpg) aldolase from pseudomonas putida. (see paper)
25% identity, 97% coverage: 1:217/223 of query aligns to 1:213/216 of 1mxsA
5xsfA Crystal structure of the 2-keto-3-deoxy-6-phosphogluconate aldolase of zymomonas mobilis zm4 with 3-phosphoglycerate
26% identity, 89% coverage: 18:216/223 of query aligns to 14:203/209 of 5xsfA
>350017 FitnessBrowser__Btheta:350017
MAKFDKIAVLNKIGSTGMVPVFYHKDAEVAKKVVKACYDGGVRAFEFTNRGDFAQEVFAE
IVKYAAKECPEMAIGIGSIVDPATAAMYLQLGANFVVGPLFNPEIAKICNRRLVAYTPGC
GSVSEVGFAQEVGCDLCKVFPGDVYGTNFVKGLMAPMPWSKLMVTGGVEPSKENLTAWIK
AGVFCVGMGSKLFPKDKVAAEDWAYVTAKCEEALSYIAEARKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory