SitesBLAST
Comparing 350049 FitnessBrowser__Btheta:350049 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3nz2J Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
38% identity, 52% coverage: 89:195/207 of query aligns to 77:183/185 of 3nz2J
- binding acetyl coenzyme *a: G104 (= G121), Y110 (≠ Q127), H114 (≠ K131), W138 (= W150), G140 (= G152), A158 (= A170), A159 (= A171), N164 (≠ S176), G174 (≠ A186), T176 (≠ C188), P177 (= P189), R182 (≠ K194)
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
38% identity, 52% coverage: 89:195/207 of query aligns to 74:180/183 of 3nz2C
- binding acetyl coenzyme *a: Y107 (≠ Q127), H111 (≠ K131), G137 (= G152), A155 (= A170), A156 (= A171), N161 (≠ S176), G171 (≠ A186), T173 (≠ C188), P174 (= P189), L178 (≠ I193), R179 (≠ K194)
- binding magnesium ion: N157 (≠ G172), T173 (≠ C188)
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
38% identity, 52% coverage: 89:195/207 of query aligns to 67:173/176 of 3ectA
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 56% coverage: 88:203/207 of query aligns to 90:192/203 of P07464
- D93 (= D91) binding
- H115 (= H124) mutation to A: Results in an 1800-fold decrease in catalytic activity.
- S142 (≠ A153) binding in other chain
- A160 (= A171) binding in other chain
- TK 165:166 (≠ SR 176:177) binding
- R180 (≠ K191) binding
- R183 (≠ K194) binding in other chain
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed; Partial
- 17 binding
- 71 binding
- 85 binding in other chain; binding in other chain
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
34% identity, 56% coverage: 88:203/207 of query aligns to 89:191/200 of 1krrA
- binding acetyl coenzyme *a: I103 (≠ L113), A104 (= A114), P105 (≠ Q115), T112 (≠ L122), H114 (= H124), G140 (= G152), S141 (≠ A153), N146 (≠ L158), G158 (≠ A170), A159 (= A171), A174 (= A186), P177 (= P189), R182 (≠ K194)
Sites not aligning to the query:
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
34% identity, 56% coverage: 88:203/207 of query aligns to 89:191/201 of 1krvA
- binding 4-nitrophenyl beta-D-galactopyranoside: V90 (≠ I89), D92 (= D91), M126 (≠ V138)
- binding coenzyme a: A104 (= A114), S110 (≠ T120), T112 (≠ L122), W138 (= W150), G140 (= G152), S141 (≠ A153), N146 (≠ L158), A159 (= A171), P177 (= P189), R179 (≠ K191), R182 (≠ K194)
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
34% identity, 56% coverage: 88:203/207 of query aligns to 89:191/201 of 1kruA
- binding coenzyme a: H114 (= H124), W138 (= W150), G140 (= G152), S141 (≠ A153), G158 (≠ A170), A159 (= A171), P177 (= P189), R182 (≠ K194)
- binding 1-methylethyl 1-thio-beta-D-galactopyranoside: V90 (≠ I89), D92 (= D91), L102 (≠ N112), H114 (= H124), M126 (≠ V138)
Sites not aligning to the query:
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
31% identity, 62% coverage: 69:197/207 of query aligns to 61:187/188 of 3igjC
- binding acetyl coenzyme *a: F84 (≠ I89), A106 (= A114), Y112 (≠ T120), A114 (≠ L122), H116 (= H124), G142 (= G152), N148 (≠ L158), A160 (= A170), S161 (≠ A171), T166 (≠ S176), N178 (≠ C188)
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
36% identity, 43% coverage: 105:194/207 of query aligns to 95:182/186 of 4isxA
Sites not aligning to the query:
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
33% identity, 46% coverage: 103:197/207 of query aligns to 93:185/190 of 5u2kA
Sites not aligning to the query:
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
31% identity, 58% coverage: 84:203/207 of query aligns to 56:175/211 of 4hurA
- binding acetyl coenzyme *a: S67 (≠ R94), I68 (= I95), G69 (= G96), A79 (≠ G108), N80 (= N109), K110 (≠ S139), W120 (= W150), I121 (≠ V151), G122 (= G152), R123 (≠ A153), M128 (≠ L158), A140 (= A170), A141 (= A171), T146 (≠ S176), G156 (≠ A186), P159 (= P189), I163 (= I193), R164 (≠ K194)
Sites not aligning to the query:
6x3cA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
31% identity, 58% coverage: 84:203/207 of query aligns to 56:175/207 of 6x3cA
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: G78 (≠ I107), N80 (= N109), H81 (= H110), H91 (≠ T120), L92 (≠ G121), M101 (≠ E130), P102 (≠ K131), L104 (≠ I133)
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: G69 (= G96), N80 (= N109), H81 (= H110), W120 (= W150), G122 (= G152), R123 (≠ A153), M128 (≠ L158), A140 (= A170), A141 (= A171)
Sites not aligning to the query:
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: 17, 36, 53
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: 51
4husA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1 (see paper)
31% identity, 58% coverage: 84:203/207 of query aligns to 56:175/212 of 4husA
Sites not aligning to the query:
6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
31% identity, 58% coverage: 84:203/207 of query aligns to 56:175/206 of 6x3jA
- binding (2R)-2-[(3S,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-4,12-dimethyl-1,7,22-trioxo-4,7,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,3H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosin-3-yl]propyl isoquinolin-3-ylcarbamate: H91 (≠ T120), L92 (≠ G121), M101 (≠ E130), P102 (≠ K131), L107 (≠ Q136)
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: G69 (= G96), A79 (≠ G108), H81 (= H110), W120 (= W150), G122 (= G152)
Sites not aligning to the query:
- binding (2R)-2-[(3S,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-4,12-dimethyl-1,7,22-trioxo-4,7,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,3H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosin-3-yl]propyl isoquinolin-3-ylcarbamate: 51, 53, 55
6x3cE Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
31% identity, 58% coverage: 84:203/207 of query aligns to 56:175/203 of 6x3cE
- binding magnesium ion: N158 (≠ C188), P159 (= P189)
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: G78 (≠ I107), N80 (= N109), H81 (= H110), H91 (≠ T120), L92 (≠ G121), M101 (≠ E130), P102 (≠ K131)
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: G69 (= G96), H81 (= H110), M83 (≠ N112), W120 (= W150), G122 (= G152), A140 (= A170), A141 (= A171)
Sites not aligning to the query:
- binding (3R,4R,5E,10E,12E,14S,16R,26aR)-16-fluoro-14-hydroxy-12-methyl-3-(propan-2-yl)-4-(prop-2-en-1-yl)-3,4,8,9,14,15,16,17,24,25,26,26a-dodecahydro-1H,7H,22H-21,18-(azeno)pyrrolo[2,1-c][1,8,4,19]dioxadiazacyclotetracosine-1,7,22-trione: 53
- binding thioacetic acid s-{2-[3-(2-hydroxy-3,3-dimethyl-4-phosphonooxy-butyrylamino)-propionylamino]-ethyl} ester: 51
P50870 Streptogramin A acetyltransferase; Virginiamycin acetyltransferase D; Vat(D); EC 2.3.1.- from Enterococcus faecium (Streptococcus faecium) (see paper)
33% identity, 53% coverage: 87:195/207 of query aligns to 61:166/209 of P50870
- H82 (= H110) mutation to A: 105-fold decrease in activity.
4mzuB Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
31% identity, 55% coverage: 79:192/207 of query aligns to 38:139/290 of 4mzuB
- binding coenzyme a: F72 (≠ N112), T80 (= T120), N81 (= N123), D82 (≠ H124), K83 (≠ N125), P85 (≠ Q127), G99 (= G152), A100 (= A153), G117 (≠ A170), A118 (= A171), T123 (≠ S176), K124 (≠ R177), I133 (≠ A186), R138 (≠ K191)
- binding magnesium ion: G58 (= G98), N76 (= N116)
- binding thymine: C38 (= C79), A39 (≠ L80)
Sites not aligning to the query:
3dhoA Structure of streptogramin acetyltransferase in complex with an inhibitor
33% identity, 53% coverage: 87:195/207 of query aligns to 61:166/203 of 3dhoA
4mzuF Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
30% identity, 55% coverage: 79:192/207 of query aligns to 38:140/294 of 4mzuF
- binding coenzyme a: N81 (≠ G121), D82 (= D134), K83 (≠ E135), G100 (= G152), A101 (= A153), L106 (= L158), G118 (≠ A170), A119 (= A171), T124 (≠ S176), K125 (≠ R177), I134 (≠ A186), N136 (≠ C188), R139 (≠ K191)
- binding thymine: C38 (= C79)
Sites not aligning to the query:
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
33% identity, 53% coverage: 87:195/207 of query aligns to 61:166/204 of 1mrlA
- binding 5-(2-diethylamino-ethanesulfonyl)-21-hydroxy-10-isopropyl-11,19-dimethyl-9,26-dioxa-3,15,28-triaza-tricyclo[23.2.1.00,255]octacosa-1(27),12,17,19,25(28)-pentaene-2,8,14,23-tetraone: N81 (= N109), H82 (= H110), L93 (≠ G121), M102 (≠ E130), L108 (≠ Q136)
Sites not aligning to the query:
- binding 5-(2-diethylamino-ethanesulfonyl)-21-hydroxy-10-isopropyl-11,19-dimethyl-9,26-dioxa-3,15,28-triaza-tricyclo[23.2.1.00,255]octacosa-1(27),12,17,19,25(28)-pentaene-2,8,14,23-tetraone: 37, 39, 54, 56
Query Sequence
>350049 FitnessBrowser__Btheta:350049
MEKRTLKQRIKQNPALKQAVHRFIMHPVKTRPNWWIRLFYFVYLKRGKGSVIYRSVRKDL
PPFNQFSLGRYSVVEDFSCLNNAVGDLIIGDYTRIGLGNTIIGPVRIGNHVNLAQNITVT
GLNHNYQDAEKSIDEQGVSTQPVTIEDDVWVGANSVILPGVTLGKHCVVAAGSVVSRSIP
AYSICAGCPAKVIKSYDFATKEWKKVK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory