Comparing 350054 FitnessBrowser__Btheta:350054 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A962 L-asparaginase 1; L-asparaginase I; L-ASNase I; L-asparagine amidohydrolase I; EC 3.5.1.1 from Escherichia coli (strain K12) (see paper)
45% identity, 99% coverage: 3:344/346 of query aligns to 1:335/338 of P0A962
6nxcB Ecai(t162a) mutant in complex with citrate at ph 4 (see paper)
46% identity, 99% coverage: 3:344/346 of query aligns to 8:334/336 of 6nxcB
2himA Crystal structure and allosteric regulation of the cytoplasmic escherichia coli l-asparaginase i (see paper)
46% identity, 98% coverage: 7:344/346 of query aligns to 3:323/324 of 2himA
7r6bB Crystal structure of mutant r43d/l124d/r125a/c273s of l-asparaginase i from yersinia pestis (see paper)
44% identity, 98% coverage: 7:344/346 of query aligns to 3:300/301 of 7r6bB
4r8lA Crystal structure of the asp-bound guinea pig l-asparaginase 1 catalytic domain (see paper)
41% identity, 95% coverage: 8:336/346 of query aligns to 4:352/354 of 4r8lA
5dndD Crystal structure of the asn-bound guinea pig l-asparaginase 1 catalytic domain active site mutant t116a (see paper)
41% identity, 95% coverage: 8:336/346 of query aligns to 4:352/357 of 5dndD
5ot0A The thermostable l-asparaginase from thermococcus kodakarensis (see paper)
35% identity, 97% coverage: 8:344/346 of query aligns to 3:326/328 of 5ot0A
1zq1A Structure of gatde tRNA-dependent amidotransferase from pyrococcus abyssi (see paper)
34% identity, 98% coverage: 6:344/346 of query aligns to 91:427/437 of 1zq1A
4q0mA Crystal structure of pyrococcus furiosus l-asparaginase (see paper)
30% identity, 97% coverage: 8:343/346 of query aligns to 4:325/327 of 4q0mA
Q8TZE8 L-asparaginase; EC 3.5.1.1 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 2 papers)
30% identity, 97% coverage: 8:343/346 of query aligns to 3:324/326 of Q8TZE8
4njeA Crystal structure of pyrococcus furiosus l-asparaginase with ligand (see paper)
33% identity, 53% coverage: 8:190/346 of query aligns to 3:174/182 of 4njeA
5b5uA Crystal structure of truncated pyrococcus furiosus l-asparaginase with peptide (see paper)
33% identity, 53% coverage: 8:190/346 of query aligns to 3:174/175 of 5b5uA
Sites not aligning to the query:
1jazA Crystal structure of monoclinic form of d90e mutant of escherichia coli asparaginase ii (see paper)
28% identity, 81% coverage: 6:286/346 of query aligns to 2:258/307 of 1jazA
Sites not aligning to the query:
7r5qA Escherichia coli type ii asparaginase n24s mutant in complex with glu (see paper)
28% identity, 81% coverage: 6:286/346 of query aligns to 2:257/306 of 7r5qA
1ho3A Crystal structure analysis of e. Coli l-asparaginase ii (y25f mutant) (see paper)
30% identity, 73% coverage: 34:286/346 of query aligns to 33:277/326 of 1ho3A
Sites not aligning to the query:
P00805 L-asparaginase 2; L-asparaginase II; L-ASNase II; L-asparagine amidohydrolase II; Colaspase; EC 3.5.1.1 from Escherichia coli (strain K12) (see 5 papers)
29% identity, 73% coverage: 34:286/346 of query aligns to 55:299/348 of P00805
Sites not aligning to the query:
2wltA The crystal structure of helicobacter pylori l-asparaginase at 1.4 a resolution (see paper)
27% identity, 83% coverage: 6:293/346 of query aligns to 2:285/326 of 2wltA
1hg1A X-ray structure of the complex between erwinia chrysanthemi l-asparaginase and d-aspartate (see paper)
25% identity, 82% coverage: 6:287/346 of query aligns to 2:263/306 of 1hg1A
1hg0A X-ray structure of the complex between erwinia chrysanthemi l- asparaginase and succinic acid (see paper)
26% identity, 82% coverage: 6:287/346 of query aligns to 5:284/327 of 1hg0A
P06608 L-asparaginase; L-ASNase; L-asparagine amidohydrolase; EC 3.5.1.1 from Dickeya chrysanthemi (Pectobacterium chrysanthemi) (Erwinia chrysanthemi) (see 2 papers)
25% identity, 82% coverage: 6:287/346 of query aligns to 26:305/348 of P06608
>350054 FitnessBrowser__Btheta:350054
MRVETPSVLLIYTGGTIGMIENPETGALENFNFDHLLKHVPELKRFNYRISSYQFDPPLD
SSDMEPAYWAKLVKIINYNYDYFDGFVILHGTDTMAYTASALSFMLENLSKPVILTGSQL
PIGTLRTDGKENLITAIEIAAAKNPDGTAIVPEVCIFFENHLMRGNRTTKINAENFNAFR
SFNYPPLARVGIHIKYEPNLIRKPDPDKPLKPHYLFDTNVVILTLFPGIQEEIIHSLLHV
PGLKAVVMKTFGSGNAPQKEWFIRELKEATDRGIIIVNITQCASGAVEMGRYETGMHLLE
AGVISGYDSTPECAVTKLMFLLGHGLSNKDIRYKMNSCLIGEITKP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory