SitesBLAST
Comparing 350061 FitnessBrowser__Btheta:350061 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8egzB Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate
59% identity, 97% coverage: 10:390/394 of query aligns to 2:379/386 of 8egzB
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H89), K82 (= K90), T105 (= T113), G106 (= G114), A107 (= A115), Q109 (= Q117), H110 (= H118), S185 (= S193), G229 (= G238), S230 (= S239), N231 (= N240), G297 (= G307), E344 (= E354), S367 (= S378)
8eh0A Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate and complexed with quinoline n-oxide
59% identity, 97% coverage: 10:390/394 of query aligns to 1:378/385 of 8eh0A
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H80 (= H89), K81 (= K90), T104 (= T113), G105 (= G114), A106 (= A115), Q108 (= Q117), H109 (= H118), S184 (= S193), G228 (= G238), S229 (= S239), N230 (= N240), G296 (= G307), E343 (= E354), S366 (= S378), G367 (= G379)
- binding 1-oxo-1lambda~5~-quinoline: L160 (= L169), I164 (≠ T173), Y180 (= Y189), P182 (≠ I191), G183 (= G192), S184 (= S193), V186 (= V195), Y299 (= Y310)
8egyA Engineered holo tyrosine synthase (tmtyrs1) derived from t. Maritima trpb
59% identity, 97% coverage: 10:390/394 of query aligns to 1:378/385 of 8egyA
8eh1A Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate and complexed with 4-hydroxyquinoline
59% identity, 97% coverage: 10:390/394 of query aligns to 1:378/383 of 8eh1A
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H80 (= H89), K81 (= K90), T104 (= T113), G105 (= G114), A106 (= A115), Q108 (= Q117), H109 (= H118), S184 (= S193), G228 (= G238), S229 (= S239), N230 (= N240), G296 (= G307), E343 (= E354), S366 (= S378)
- binding quinolin-4-ol: G103 (≠ E112), L160 (= L169), I164 (≠ T173), G183 (= G192), S184 (= S193), Y299 (= Y310)
5ey5B Lbcats
59% identity, 96% coverage: 10:387/394 of query aligns to 1:380/383 of 5ey5B
- binding pyridoxal-5'-phosphate: H81 (= H89), K82 (= K90), Q109 (= Q117), S185 (= S193), G227 (= G236), G229 (= G238), S230 (= S239), N231 (= N240), E345 (= E354), S371 (= S378), G372 (= G379)
5t6mB Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
53% identity, 97% coverage: 11:392/394 of query aligns to 2:385/386 of 5t6mB
1v8zA X-ray crystal structure of the tryptophan synthase b2 subunit from hyperthermophile, pyrococcus furiosus (see paper)
53% identity, 97% coverage: 11:392/394 of query aligns to 2:385/386 of 1v8zA
- active site: K82 (= K90), E104 (= E112), S371 (= S378)
- binding pyridoxal-5'-phosphate: H81 (= H89), K82 (= K90), Q109 (= Q117), S185 (= S193), G227 (= G236), G228 (= G237), G229 (= G238), S230 (= S239), N231 (= N240), E345 (= E354), S371 (= S378), G372 (= G379)
6am8B Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9 with trp bound as e(aex2) (see paper)
54% identity, 96% coverage: 11:389/394 of query aligns to 2:382/385 of 6am8B
- active site: K82 (= K90), E104 (= E112), S371 (= S378)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-l-tryptophane: H81 (= H89), K82 (= K90), E104 (= E112), T105 (= T113), G106 (= G114), A107 (= A115), Q109 (= Q117), H110 (= H118), L161 (= L169), S185 (= S193), V187 (= V195), G227 (= G236), G228 (= G237), G229 (= G238), S230 (= S239), N231 (= N240), G298 (= G307), Y301 (= Y310), E345 (= E354), S371 (= S378), G372 (= G379)
- binding tryptophan: P12 (= P21), L169 (≠ I177), S274 (≠ I283), H275 (= H284)
5dw0A Trpb from pyrococcus furiosus with l-serine bound as the external aldimine (see paper)
53% identity, 97% coverage: 11:392/394 of query aligns to 2:385/388 of 5dw0A
- active site: K82 (= K90), E104 (= E112), S371 (= S378)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H81 (= H89), K82 (= K90), T105 (= T113), G106 (= G114), A107 (= A115), Q109 (= Q117), H110 (= H118), S185 (= S193), G227 (= G236), G229 (= G238), S230 (= S239), N231 (= N240), G298 (= G307), D300 (= D309), E345 (= E354), S371 (= S378)
7rnpA Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound (see paper)
53% identity, 96% coverage: 11:389/394 of query aligns to 2:382/384 of 7rnpA
5dw3A Tryptophan synthase beta-subunit from pyrococcus furiosus with product l-tryptophan non-covalently bound in the active site (see paper)
53% identity, 96% coverage: 11:389/394 of query aligns to 2:381/383 of 5dw3A
- active site: K82 (= K90), E104 (= E112), S370 (= S378)
- binding tryptophan: K82 (= K90), E104 (= E112), T105 (= T113), G106 (= G114), A107 (= A115), Q109 (= Q117), H110 (= H118), S185 (= S193), G228 (= G237), Y300 (= Y310)
5t6mA Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
53% identity, 97% coverage: 11:392/394 of query aligns to 2:383/383 of 5t6mA
5vm5D Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9, with ser bound (see paper)
54% identity, 96% coverage: 11:389/394 of query aligns to 2:380/383 of 5vm5D
- active site: K82 (= K90), E104 (= E112), S369 (= S378)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H89), K82 (= K90), T105 (= T113), G106 (= G114), A107 (= A115), Q109 (= Q117), H110 (= H118), S185 (= S193), G227 (= G236), G229 (= G238), S230 (= S239), N231 (= N240), G296 (= G307), E343 (= E354), S369 (= S378)
5ixjD Tryptophan synthase beta-subunit from pyrococcus furiosus with l- threonine non-covalently bound in the active site (see paper)
53% identity, 97% coverage: 11:392/394 of query aligns to 2:383/394 of 5ixjD
6cuzA Engineered trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3r)- ethylserine bound as the amino-acrylate (see paper)
53% identity, 96% coverage: 11:389/394 of query aligns to 2:382/383 of 6cuzA
- binding (2E)-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]pent-2-enoic acid: H81 (= H89), K82 (= K90), T105 (= T113), G106 (= G114), A107 (= A115), Q109 (= Q117), H110 (= H118), S185 (= S193), G227 (= G236), G229 (= G238), S230 (= S239), N231 (= N240), G298 (= G307), E345 (= E354), S371 (= S378)
6cutA Engineered holo trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3s)- isopropylserine bound as the external aldimine (see paper)
53% identity, 96% coverage: 11:389/394 of query aligns to 2:382/385 of 6cutA
- binding (2S,3S)-3-hydroxy-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-4-methylpentanoic acid (non-preferred name): H81 (= H89), K82 (= K90), T105 (= T113), G106 (= G114), A107 (= A115), Q109 (= Q117), H110 (= H118), S185 (= S193), G227 (= G236), G229 (= G238), S230 (= S239), N231 (= N240), G298 (= G307), E345 (= E354), S371 (= S378)
5kzmB Crystal structure of tryptophan synthase alpha-beta chain complex from francisella tularensis (see paper)
53% identity, 96% coverage: 9:387/394 of query aligns to 5:385/395 of 5kzmB
5ocwB Structure of mycobacterium tuberculosis tryptophan synthase in space group f222 (see paper)
52% identity, 97% coverage: 7:387/394 of query aligns to 6:391/399 of 5ocwB
- active site: K93 (= K90), E115 (= E112), S382 (= S378)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H92 (= H89), K93 (= K90), T116 (= T113), G117 (= G114), A118 (= A115), Q120 (= Q117), H121 (= H118), T196 (≠ S193), G238 (= G236), G240 (= G238), S241 (= S239), N242 (= N240), G309 (= G307), E356 (= E354), S382 (= S378)
6u6cB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk2-bound form (see paper)
52% identity, 97% coverage: 7:387/394 of query aligns to 11:396/405 of 6u6cB
- active site: K98 (= K90), E120 (= E112), S387 (= S378)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H97 (= H89), K98 (= K90), T121 (= T113), G122 (= G114), A123 (= A115), Q125 (= Q117), H126 (= H118), T201 (≠ S193), G243 (= G236), G245 (= G238), S246 (= S239), N247 (= N240), G314 (= G307), E361 (= E354), S387 (= S378)
- binding 1-(2-fluorobenzene-1-carbonyl)-N-methyl-2,3-dihydro-1H-indole-5-sulfonamide: Y26 (= Y19), F185 (≠ I177), W188 (= W180), Y197 (= Y189), F199 (≠ I191), G204 (= G196), P205 (= P197), H291 (= H284), G292 (= G285)
5tciH Crystal structure of tryptophan synthase from m. Tuberculosis - brd4592-bound form (see paper)
52% identity, 97% coverage: 7:387/394 of query aligns to 11:396/406 of 5tciH
- active site: K98 (= K90), E120 (= E112), S387 (= S378)
- binding (2R,3S,4R)-3-(2'-fluoro[1,1'-biphenyl]-4-yl)-4-(hydroxymethyl)azetidine-2-carbonitrile: P28 (= P21), L31 (= L24), Y197 (= Y189), F199 (≠ I191), P205 (= P197), F208 (≠ Y200), H291 (= H284)
Query Sequence
>350061 FitnessBrowser__Btheta:350061
MKSFLVDQDGYYGEFGGAYVPEILHKCVEELKNTYLGVLESEDFKKEFDQLLRDYVGRPS
PLYLARRLSEKYGCKMYLKREDLNHTGAHKINNTIGQILLARRMGKKRIIAETGAGQHGV
ATATVCALMDMECIVYMGKTDVERQHINVEKMKMLGATVIPVTSGNMTLKDATNEAIRDW
CCHPADTYYIIGSTVGPHPYPDMVARLQSVISEEIKKQLMEKEGRDHPDYLIACVGGGSN
AAGTIYHYINDGRVGIILAEAGGKGIETGMTAATIQLGKMGIIHGARTYVIQNEDGQIEE
PYSISAGLDYPGIGPIHANLAAQRRATVLAVNDDEAIEAAYELTKLEGIIPALESAHALG
ALKKLKFKPEDVVVLTVSGRGDKDIETYLSFNEK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory