SitesBLAST
Comparing 350063 FitnessBrowser__Btheta:350063 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q46856 Alcohol dehydrogenase YqhD; EC 1.1.1.2 from Escherichia coli (strain K12) (see paper)
51% identity, 100% coverage: 1:380/381 of query aligns to 1:386/387 of Q46856
- GGS 38:40 (= GGS 38:40) binding
- 93:99 (vs. 93:99, 86% identical) binding
- T138 (= T135) binding
- N147 (= N144) binding
- K160 (= K157) binding
- YTYT 179:182 (≠ VTFT 174:177) binding
- D194 (= D189) binding
- H198 (= H193) binding
- H267 (= H262) binding
- H281 (= H276) binding
1oj7B Structural genomics, unknown function crystal structure of e. Coli k-12 yqhd (see paper)
50% identity, 100% coverage: 1:380/381 of query aligns to 4:389/390 of 1oj7B
- binding 5,6-dihydroxy-nadp: G41 (= G38), S43 (= S40), P70 (= P67), N71 (= N68), G97 (= G94), G98 (= G95), S99 (= S96), D102 (= D99), T141 (= T135), L142 (= L136), T145 (= T139), S147 (= S141), G152 (= G146), V154 (= V148), K163 (= K157), T185 (= T177), L186 (= L178), P187 (= P179), Q190 (= Q182), H201 (= H193), H270 (= H262), H284 (= H276)
- binding zinc ion: D197 (= D189), H201 (= H193), H270 (= H262), H284 (= H276)
1oj7A Structural genomics, unknown function crystal structure of e. Coli k-12 yqhd (see paper)
50% identity, 100% coverage: 1:380/381 of query aligns to 4:389/390 of 1oj7A
- binding 5,6-dihydroxy-nadp: G41 (= G38), S43 (= S40), P70 (= P67), N71 (= N68), G97 (= G94), G98 (= G95), S99 (= S96), D102 (= D99), T141 (= T135), L142 (= L136), T145 (= T139), S147 (= S141), N150 (= N144), G152 (= G146), K163 (= K157), T185 (= T177), L186 (= L178), Q190 (= Q182), D197 (= D189), H201 (= H193), H270 (= H262), H284 (= H276)
7w9yA Crystal structure of bacillus subtilis yugj in complex with NADP and nickel (see paper)
42% identity, 100% coverage: 1:381/381 of query aligns to 3:389/389 of 7w9yA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G40 (= G37), G41 (= G38), S43 (= S40), P72 (= P67), N73 (= N68), G99 (= G94), G100 (= G95), S101 (= S96), T140 (= T135), L141 (= L136), T144 (= T139), K162 (= K157), T184 (= T177), V185 (≠ L178), P186 (= P179), H189 (≠ Q182), H283 (= H276)
7w9zA Crystal structure of bacillus subtilis yugj in complex with NADP and nitrate (see paper)
43% identity, 92% coverage: 3:354/381 of query aligns to 2:360/381 of 7w9zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G37 (= G37), G38 (= G38), S40 (= S40), P69 (= P67), G96 (= G94), G97 (= G95), S98 (= S96), D101 (= D99), T137 (= T135), L138 (= L136), T141 (= T139), N146 (= N144), G148 (= G146), K159 (= K157), T181 (= T177), V182 (≠ L178), P183 (= P179), H186 (≠ Q182)
- binding nitrate ion: R72 (≠ A70), V73 (≠ I71), S74 (≠ E72), V150 (= V148), N153 (≠ R151), W154 (≠ H152), E155 (= E153), W263 (= W259), H270 (= H266), H280 (= H276)
1vljB Crystal structure of nadh-dependent butanol dehydrogenase a (tm0820) from thermotoga maritima at 1.78 a resolution
36% identity, 100% coverage: 1:380/381 of query aligns to 6:398/400 of 1vljB
- binding fe (iii) ion: D200 (= D189), H204 (= H193), H273 (= H262), H287 (= H276)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G45 (= G38), S47 (= S40), P76 (= P67), G103 (= G94), G104 (= G95), S105 (= S96), D108 (= D99), T144 (= T135), I145 (≠ L136), T148 (= T139), T150 (≠ S141), N153 (= N144), N155 (≠ G146), K166 (= K157), T188 (= T177), L189 (= L178), Q193 (= Q182), H204 (= H193), H287 (= H276)
8i29A Crystal structure of butanol dehydrogenase a (yqdh) in complex with nadh from fusobacterium nucleatum
35% identity, 91% coverage: 2:346/381 of query aligns to 1:349/384 of 8i29A
- binding cobalt (ii) ion: E205 (= E196), H271 (= H262), H285 (= H276)
- binding nicotinamide-adenine-dinucleotide: A102 (≠ G95), T142 (= T135), I143 (≠ L136), A146 (≠ T139), S148 (= S141), S151 (≠ N144), S153 (≠ G146), I155 (≠ V148), T186 (= T177), I187 (≠ L178), L191 (≠ Q182)
7fjgA Crystal structure of butanol dehydrogenase a (yqdh) in complex with partial nadh from fusobacterium nucleatum
35% identity, 91% coverage: 2:346/381 of query aligns to 1:349/384 of 7fjgA
3zdrA Structure of the alcohol dehydrogenase (adh) domain of a bifunctional adhe dehydrogenase from geobacillus thermoglucosidasius ncimb 11955 (see paper)
26% identity, 89% coverage: 6:343/381 of query aligns to 5:333/403 of 3zdrA
6jkpA Crystal structure of sulfoacetaldehyde reductase from bifidobacterium kashiwanohense in complex with NAD+ (see paper)
23% identity, 77% coverage: 62:353/381 of query aligns to 63:346/376 of 6jkpA
Sites not aligning to the query:
6jkoA Crystal structure of sulfoacetaldehyde reductase from bifidobacterium kashiwanohense (see paper)
23% identity, 77% coverage: 62:353/381 of query aligns to 63:346/376 of 6jkoA
5yvmA Crystal structure of the archaeal halo-thermophilic red sea brine pool alcohol dehydrogenase adh/d1 bound to nzq (see paper)
26% identity, 89% coverage: 12:351/381 of query aligns to 15:371/403 of 5yvmA
- binding manganese (ii) ion: D207 (= D189), H211 (= H193), H276 (= H262), H291 (= H276)
- binding 5,6-dihydroxy-nadp: G41 (= G37), N44 (≠ S40), M45 (≠ V41), P73 (= P67), N74 (= N68), G100 (= G94), G101 (= G95), S102 (= S96), D105 (= D99), S151 (≠ T135), T152 (≠ L136), T155 (= T139), T160 (≠ N144), Y162 (≠ G146), V164 (= V148), K173 (= K157), E195 (≠ T177), L200 (≠ Q182), H211 (= H193), H276 (= H262), H280 (= H266), H291 (= H276)
3bfjA Crystal structure analysis of 1,3-propanediol oxidoreductase (see paper)
27% identity, 80% coverage: 30:334/381 of query aligns to 32:344/382 of 3bfjA
5yvrA Crystal structure of the h277a mutant of adh/d1, an archaeal halo- thermophilic red sea brine pool alcohol dehydrogenase (see paper)
26% identity, 89% coverage: 12:351/381 of query aligns to 15:371/403 of 5yvrA
- binding manganese (ii) ion: D207 (= D189), H211 (= H193), H276 (= H262), H291 (= H276)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G41 (= G37), S43 (≠ G39), N44 (≠ S40), M45 (≠ V41), G100 (= G94), G101 (= G95), S102 (= S96), D105 (= D99), S151 (≠ T135), T152 (≠ L136), T155 (= T139), T160 (≠ N144), Y162 (≠ G146), V164 (= V148), K173 (= K157), E195 (≠ T177), M196 (≠ L178), L200 (≠ Q182), D207 (= D189), H211 (= H193), H291 (= H276)
6c75B Structure of iron containing alcohol dehydrogenase from thermococcus thioreducens in a monoclinic crystal form (see paper)
30% identity, 65% coverage: 5:251/381 of query aligns to 1:252/378 of 6c75B
6c75A Structure of iron containing alcohol dehydrogenase from thermococcus thioreducens in a monoclinic crystal form (see paper)
30% identity, 65% coverage: 5:251/381 of query aligns to 1:252/378 of 6c75A
- binding fe (iii) ion: D193 (= D189), H197 (= H193)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S33 (≠ G38), S35 (= S40), G91 (= G94), G92 (= G95), S93 (= S96), D96 (= D99), S139 (≠ A138), T140 (= T139), A143 (vs. gap), S148 (≠ N144), V152 (= V148), K159 (= K155), T181 (= T177), M182 (≠ L178), P183 (= P179), V186 (≠ Q182), F251 (= F250)
Sites not aligning to the query:
1o2dA Crystal structure of alcohol dehydrogenase, iron-containing (tm0920) from thermotoga maritima at 1.30 a resolution (see paper)
25% identity, 71% coverage: 30:299/381 of query aligns to 29:293/359 of 1o2dA
- binding fe (iii) ion: D189 (= D189), H193 (= H193), H256 (= H262), H270 (= H276)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S38 (≠ G39), S39 (= S40), E68 (≠ P67), N69 (= N68), G95 (= G94), G96 (= G95), S97 (= S96), D100 (= D99), T136 (= T135), T137 (≠ L136), T140 (= T139), S142 (= S141), Y147 (≠ G146), I149 (≠ V148), K157 (= K157), S177 (≠ T177), M178 (≠ L178), L182 (≠ Q182), D189 (= D189), H193 (= H193), H270 (= H276)
P31005 NAD-dependent methanol dehydrogenase; MDH; MEDH; Type 3 alcohol dehydrogenase; EC 1.1.1.244 from Bacillus methanolicus (see 3 papers)
25% identity, 91% coverage: 1:348/381 of query aligns to 1:348/381 of P31005
- M1 (= M1) modified: Initiator methionine, Removed
- G13 (= G15) mutation to A: Shows a reduced dehydrogenase activity.
- G15 (= G17) mutation to A: Shows almost the same dehydrogenase activity as the wild-type.
- D88 (= D87) mutation to N: Shows almost the same dehydrogenase activity as the wild-type.
- G95 (= G94) mutation to A: Shows a 10-fold decreased affinity for NAD and NADH and a strongly reduced dehydrogenase activity. Completely insensitive to the stimulating effect of the activator protein Act.
- S97 (= S96) mutation to G: Shows an increase of the dehydrogenase activity and a decrease of the affinity for NAD and NADH. Completely insensitive to the stimulating effect of the activator protein Act. It does not bind NAD.; mutation to T: Shows an increase of the dehydrogenase activity and affinity for NAD and NADH.
- D100 (= D99) mutation to N: Loss of dehydrogenase activity. It still binds NADH.
- K103 (= K102) mutation to R: Loss of dehydrogenase activity. It does not bind NADH.
1vhdA Crystal structure of an iron containing alcohol dehydrogenase (see paper)
25% identity, 71% coverage: 30:299/381 of query aligns to 30:294/361 of 1vhdA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S39 (≠ G39), S40 (= S40), E69 (≠ P67), N70 (= N68), G96 (= G94), G97 (= G95), S98 (= S96), D101 (= D99), T137 (= T135), T138 (≠ L136), T141 (= T139), S143 (= S141), T146 (≠ N144), Y148 (≠ G146), I150 (≠ V148), K158 (= K157), S178 (≠ T177), M179 (≠ L178), L183 (≠ Q182), D190 (= D189), H194 (= H193), H271 (= H276)
- binding zinc ion: D190 (= D189), H194 (= H193), H257 (= H262), H271 (= H276)
Q59104 4-hydroxybutyrate dehydrogenase; 4HbD; Gamma-hydroxybutyrate dehydrogenase; GHBDH; EC 1.1.1.61 from Cupriavidus necator (Alcaligenes eutrophus) (Ralstonia eutropha) (see paper)
29% identity, 65% coverage: 41:289/381 of query aligns to 40:293/382 of Q59104
- D193 (= D189) mutation to A: Retains very low activity.
- H197 (= H193) mutation to A: Loss of activity.
- H261 (≠ Q257) mutation to A: Loss of activity.
- H265 (≠ T261) mutation to A: 75% decrease in Vmax. Optimum pH is 9.5.; mutation to C: 95% decrease in Vmax. Optimum pH is 8.5.; mutation to D: Retains very low activity.; mutation to Y: Loss of activity.
- H280 (= H276) mutation to A: Retains very low activity.
Query Sequence
>350063 FitnessBrowser__Btheta:350063
MENFIFQNPVKLIMGHGMIARLSKEIPSDKRIMITFGGGSVKKNGVYDQVKEALKDHFTI
EFWGIEPNPAIETLRKAIALGKEQKVDYLLAVGGGSVIDGTKLISAGLLYDGDAWDLVLA
GRPVTKTVPLSTVLTLPATGSEMNNGAVISRHETKEKYPFYSNFPLFSILDPEVTFTLPP
HQVACGLADTFVHVMEQYMTVAGQSRVMDRWAEGILQTLVEIAPKIRENQHDYQLMADFM
LSATMALNGFIAMGVSQDWATHMIGHEITALHGLTHGHTLVIILPATLRVLREAKGDKLV
QYGERVWGITSGTKEERIDEAIDRTEEFFRSLGLTTRLHEENIGEETVLEIERRFNERGA
KYGENENVTGAVARKILEAAL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory