SitesBLAST
Comparing 350075 FitnessBrowser__Btheta:350075 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9ZQI7 Aminotransferase ALD1, chloroplastic; AGD2-like defense response protein 1; EC 2.6.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
41% identity, 99% coverage: 5:410/410 of query aligns to 41:439/456 of Q9ZQI7
- Y108 (= Y72) binding
- AQ 142:143 (≠ AK 108:109) binding
- N223 (= N188) binding
- D251 (= D216) binding
- Y254 (= Y219) binding
- S281 (= S247) binding
- S283 (= S249) binding
- R292 (= R258) binding
- N323 (= N293) binding
4fl0B Crystal structure of ald1 from arabidopsis thaliana (see paper)
41% identity, 99% coverage: 5:410/410 of query aligns to 8:406/409 of 4fl0B
- binding pyridoxal-5'-phosphate: G108 (= G107), A109 (= A108), Q110 (≠ K109), F133 (≠ Y132), N190 (= N188), D218 (= D216), Y221 (= Y219), S248 (= S247), S250 (= S249), K251 (= K250), R259 (= R258)
3qguA L,l-diaminopimelate aminotransferase from chlamydomonas reinhardtii (see paper)
44% identity, 98% coverage: 5:407/410 of query aligns to 8:402/406 of 3qguA
Sites not aligning to the query:
3ei5A Crystal structure of ll-diaminopimelate aminotransferase from arabidopsis thaliana complexed with plp-glu: an external aldimine mimic (see paper)
42% identity, 99% coverage: 5:408/410 of query aligns to 9:405/408 of 3ei5A
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: Y19 (= Y15), F21 (= F17), I45 (= I41), G46 (= G42), Y76 (= Y72), G109 (= G107), A110 (= A108), K111 (= K109), Y134 (= Y132), N191 (= N188), D219 (= D216), Y222 (= Y219), S249 (= S247), S251 (= S249), R260 (= R258), N291 (= N293), R386 (= R389)
2z1zA Crystal structure of ll-diaminopimelate aminotransferase from arabidopsis thaliana complexed with l-malate ion (see paper)
42% identity, 99% coverage: 5:408/410 of query aligns to 9:405/408 of 2z1zA
- binding pyridoxal-5'-phosphate: Y76 (= Y72), G109 (= G107), A110 (= A108), K111 (= K109), Y134 (= Y132), N191 (= N188), D219 (= D216), Y222 (= Y219), S249 (= S247), S251 (= S249), K252 (= K250), R260 (= R258), N291 (= N293)
3ei6A Crystal structure of ll-diaminopimelate aminotransferase from arabidopsis thaliana complexed with plp-dap: an external aldimine mimic (see paper)
42% identity, 99% coverage: 5:408/410 of query aligns to 9:405/410 of 3ei6A
- binding (2S,6S)-2-amino-6-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]heptanedioic acid: Y19 (= Y15), F21 (= F17), G46 (= G42), Y76 (= Y72), G109 (= G107), A110 (= A108), K111 (= K109), Y134 (= Y132), N191 (= N188), D219 (= D216), Y222 (= Y219), S249 (= S247), S251 (= S249), K252 (= K250), R260 (= R258), N291 (= N293), R386 (= R389)
Q93ZN9 LL-diaminopimelate aminotransferase, chloroplastic; AtDAP-AT; DAP-AT; DAP-aminotransferase; LL-DAP-aminotransferase; Protein ABERRANT GROWTH AND DEATH 2; EC 2.6.1.83 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
42% identity, 99% coverage: 5:408/410 of query aligns to 62:458/461 of Q93ZN9
- Y72 (= Y15) binding
- G99 (= G42) binding
- Y129 (= Y72) binding
- AK 163:164 (= AK 108:109) binding
- K164 (= K109) binding
- Y187 (= Y132) binding ; binding
- N244 (= N188) binding ; binding
- Y275 (= Y219) binding
- SFS 302:304 (= SFS 247:249) binding
- K305 (= K250) modified: N6-(pyridoxal phosphate)lysine; mutation to N: Loss of LL-DAP-aminotransferase activity.; mutation to Q: Loss of LL-DAP-aminotransferase activity.
- R313 (= R258) binding
- N344 (= N293) binding ; binding
- P398 (= P347) mutation to S: In agd2-1; reduced activity and increased resistance to pathogen.
- R439 (= R389) binding
3ei9A Crystal structure of k270n variant of ll-diaminopimelate aminotransferase from arabidopsis thaliana complexed with l-glu: external aldimine form (see paper)
42% identity, 99% coverage: 5:408/410 of query aligns to 9:405/412 of 3ei9A
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-glutamic acid: Y19 (= Y15), F21 (= F17), I45 (= I41), G46 (= G42), Y76 (= Y72), G109 (= G107), A110 (= A108), K111 (= K109), Y134 (= Y132), N191 (= N188), D219 (= D216), Y222 (= Y219), S249 (= S247), S251 (= S249), R260 (= R258), N291 (= N293), R386 (= R389)
3ei8A Crystal structure of k270n variant of ll-diaminopimelate aminotransferase from arabidopsis thaliana complexed with ll-dap: external aldimine form (see paper)
42% identity, 99% coverage: 5:408/410 of query aligns to 9:405/411 of 3ei8A
- binding (2S,6S)-2-amino-6-{[(1E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}heptanedioic acid: Y76 (= Y72), N291 (= N293)
- binding pyridoxal-5'-phosphate: G109 (= G107), A110 (= A108), K111 (= K109), Y134 (= Y132), N191 (= N188), D219 (= D216), Y222 (= Y219), S249 (= S247), S251 (= S249), R260 (= R258)
O84395 LL-diaminopimelate aminotransferase; DAP-AT; DAP-aminotransferase; LL-DAP-aminotransferase; EC 2.6.1.83 from Chlamydia trachomatis (strain D/UW-3/Cx) (see paper)
40% identity, 98% coverage: 5:407/410 of query aligns to 4:387/394 of O84395
- AK 104:105 (= AK 108:109) binding
- N174 (= N188) binding
- Y205 (= Y219) binding
- SFS 233:235 (= SFS 247:249) binding
- K236 (= K250) modified: N6-(pyridoxal phosphate)lysine
6l1oB Product bound bacf structure from bacillus subtillis (see paper)
28% identity, 95% coverage: 17:407/410 of query aligns to 17:385/392 of 6l1oB
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G103 (≠ A108), K104 (= K109), Y128 (= Y132), N174 (≠ C184), D206 (= D216), Y209 (= Y219), S236 (= S247), S238 (= S249), K239 (= K250), R247 (= R258)
- binding tyrosine: F17 (= F17), Q39 (≠ I41), G40 (= G42), K104 (= K109), Y128 (= Y132), E130 (≠ V134), Y325 (= Y348), R367 (= R389)
6l1nA Substrate bound bacf structure from bacillus subtillis (see paper)
28% identity, 95% coverage: 17:407/410 of query aligns to 17:384/393 of 6l1nA
- binding glycine: Y127 (= Y132), N177 (= N188), Y324 (= Y348), R366 (= R389)
- binding pyridoxal-5'-phosphate: G102 (≠ A108), Y127 (= Y132), N173 (≠ C184), N177 (= N188), D205 (= D216), Y208 (= Y219), S235 (= S247), S237 (= S249), R246 (= R258)
Sites not aligning to the query:
6l1lB Apo-bacf structure from bacillus subtillis (see paper)
28% identity, 95% coverage: 17:407/410 of query aligns to 17:385/393 of 6l1lB
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
28% identity, 94% coverage: 27:410/410 of query aligns to 18:382/388 of 1gdeA
- active site: K232 (= K250)
- binding glutamic acid: F120 (≠ Y132), N170 (= N188), R361 (= R389)
- binding pyridoxal-5'-phosphate: G94 (= G107), A95 (= A108), N96 (vs. gap), F120 (≠ Y132), N166 (≠ C184), D198 (= D216), Y201 (= Y219), S231 (= S249), K232 (= K250), R240 (= R258)
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
28% identity, 94% coverage: 27:410/410 of query aligns to 18:382/388 of 1gd9A
- active site: K232 (= K250)
- binding pyridoxal-5'-phosphate: G94 (= G107), A95 (= A108), N96 (vs. gap), F120 (≠ Y132), N170 (= N188), D198 (= D216), V200 (≠ A218), Y201 (= Y219), S231 (= S249), K232 (= K250), R240 (= R258)
2x5dD Crystal structure of a probable aminotransferase from pseudomonas aeruginosa (see paper)
26% identity, 91% coverage: 34:407/410 of query aligns to 17:372/380 of 2x5dD
- active site: Y113 (= Y132), D191 (= D216), A193 (= A218), K225 (= K250)
- binding pyridoxal-5'-phosphate: G87 (= G107), S88 (≠ A108), K89 (= K109), Y113 (= Y132), D191 (= D216), A193 (= A218), Y194 (= Y219), T222 (≠ S247), S224 (= S249), K225 (= K250), R233 (= R258)
2o1bA Structure of aminotransferase from staphylococcus aureus
26% identity, 92% coverage: 31:406/410 of query aligns to 16:368/376 of 2o1bA
- active site: Y115 (= Y132), D192 (= D216), A194 (= A218), K225 (= K250)
- binding pyridoxal-5'-phosphate: T90 (≠ A108), K91 (= K109), Y115 (= Y132), N164 (= N188), D192 (= D216), A194 (= A218), Y195 (= Y219), S222 (= S247), S224 (= S249), K225 (= K250), R233 (= R258)
Q9C969 Aromatic aminotransferase ISS1; Methionine aminotransferase ISS1; Phenylalanine aminotransferase ISS1; Protein INDOLE SEVERE SENSITIVE 1; Protein REVERSAL OF SAV3 PHENOTYPE 1; Tryptophan aminotransferase ISS1; Tyrosine aminotransferase ISS1; EC 2.6.1.27; EC 2.6.1.5; EC 2.6.1.88 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
26% identity, 92% coverage: 25:402/410 of query aligns to 10:375/394 of Q9C969
- P66 (= P74) mutation to L: In vas1-4; suppressor of sav3 mutant plants leading to rescued hypocotyl elongation in response to shade and restored auxin biosynthetic pathway.
- L77 (≠ I85) mutation to F: In vas1-5; suppressor of sav3 mutant plants leading to rescued hypocotyl elongation in response to shade and restored auxin biosynthetic pathway.
- G179 (= G191) mutation to D: In vas1-2; suppressor of sav3 mutant plants leading to rescued hypocotyl elongation in response to shade and restored auxin biosynthetic pathway. Increases levels of auxin (IAA) and indole-3-pyruvic acid (3-IPA).
- C219 (≠ A242) mutation to Y: In vas1-7; suppressor of sav3 mutant plants leading to rescued hypocotyl elongation in response to shade and restored auxin biosynthetic pathway.
- A269 (≠ T295) mutation to T: In vas1-8; suppressor of sav3 mutant plants leading to rescued hypocotyl elongation in response to shade and restored auxin biosynthetic pathway.
- R362 (= R389) mutation to W: In iss1-2; indole-dependent auxin (IAA) overproduction phenotypes including leaf epinasty and adventitious rooting.
5yhvB Crystal structure of an aminotransferase from mycobacterium tuberculosis
25% identity, 83% coverage: 71:410/410 of query aligns to 62:384/387 of 5yhvB
- binding 2-oxoglutaric acid: Y80 (≠ D89), H84 (≠ R93), H205 (≠ E220), T215 (≠ S231), N229 (≠ R246)
- binding pyridoxal-5'-phosphate: Y63 (= Y72), G98 (= G107), S99 (= S110), S100 (≠ D111), Y124 (= Y132), N173 (= N188), D201 (= D216), V203 (≠ A218), Y204 (= Y219), S230 (= S247), S232 (= S249), K233 (= K250), R241 (= R258), I264 (vs. gap)
5yhvA Crystal structure of an aminotransferase from mycobacterium tuberculosis
25% identity, 83% coverage: 71:410/410 of query aligns to 69:391/394 of 5yhvA
- binding glutamic acid: H91 (≠ R93), H212 (≠ E220)
- binding pyridoxal-5'-phosphate: Y70 (= Y72), G105 (= G107), S106 (= S110), S107 (≠ D111), Y131 (= Y132), N180 (= N188), Y211 (= Y219), S237 (= S247), S239 (= S249), K240 (= K250), R248 (= R258), I271 (vs. gap)
Query Sequence
>350075 FitnessBrowser__Btheta:350075
MALVNEHFLKLPGSYLFSDIAKKVNTFKITHPKQDIIRLGIGDVTQPLPKACIEAMHKAV
EELASKDTFRGYGPEQGYDFLIEAIIKNDFAPRGIHFSPSEIFVNDGAKSDTGNIGDILR
HDNSVGVTDPIYPVYIDSNVMCGRAGVLEEGTGKWSNVTYMPCTSENDFIPEIPDKRIDI
VYLCYPNNPTGTTLTKPELKKWVDYALANDTLILFDAAYEAYIQDADVPHSIYEIKGAKK
CAIEFRSFSKTAGFTGVRCGYTVVPKELTAATLEGDRIPLNKLWNRRQCTKFNGTSYITQ
RAAEAVYSTEGKAQIKETINYYMSNAKIMKEGLEATGLKVYGGVNAPYLWVKTPNGLSSW
RFFEQMLYEANVVGTPGVGFGPSGEGYIRLTAFGDHNDCMEAMRRIKNWL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory