SitesBLAST
Comparing 350146 FitnessBrowser__Btheta:350146 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
7zc6C Na+ - translocating ferredoxin: NAD+ reductase (rnf) of c. Tetanomorphum (see paper)
47% identity, 97% coverage: 2:434/445 of query aligns to 3:431/435 of 7zc6C
- binding flavin mononucleotide: G134 (= G137), K145 (= K148), N160 (= N163), C164 (= C167), G235 (= G238), A236 (≠ G239), Q263 (= Q266), N264 (= N267), M331 (= M334), C407 (= C410)
- binding iron/sulfur cluster: C365 (= C368), I366 (= I369), C368 (= C371), C371 (= C374), C375 (= C378), T382 (≠ Y385), C404 (= C407), E406 (= E409), C407 (= C410), C410 (= C413), C414 (= C417)
8ahxC Cryo-em structure of the nitrogen-fixation associated nadh:ferredoxin oxidoreductase rnf from azotobacter vinelandii
40% identity, 96% coverage: 8:433/445 of query aligns to 8:433/476 of 8ahxC
- binding flavin mononucleotide: G137 (= G137), G139 (= G139), N163 (= N163), C167 (= C167), G238 (= G238), S239 (≠ G239), H266 (≠ Q266), N267 (= N267), M334 (= M334), C410 (= C410)
- binding iron/sulfur cluster: C368 (= C368), I369 (= I369), R370 (= R370), C371 (= C371), A372 (= A372), S373 (≠ K373), C374 (= C374), C378 (= C378), P379 (= P379), C407 (= C407), I408 (= I408), L409 (≠ E409), C410 (= C410), G411 (= G411), C413 (= C413), C417 (= C417), P418 (= P418), S419 (≠ A419)
B1VB77 Cobalamin reductase PduS; Corrin reductase; Propanediol utilization protein PduS from Citrobacter freundii (see paper)
30% identity, 66% coverage: 143:437/445 of query aligns to 34:340/451 of B1VB77
- C54 (= C167) mutation to A: Colorless protein, no 4Fe-4S centers, no cobalamin reductase activity.
- C264 (= C368) mutation to A: Colorless protein, no 4Fe-4S centers, no cobalamin reductase activity.
- C267 (= C371) mutation to A: Colorless protein, no 4Fe-4S centers, no cobalamin reductase activity.
- C270 (= C374) mutation to A: Colorless protein, no 4Fe-4S centers, no cobalamin reductase activity.
- C274 (= C378) mutation to A: Colorless protein, no 4Fe-4S centers, no cobalamin reductase activity.
- C309 (= C407) mutation to A: Colorless protein, no 4Fe-4S centers, no cobalamin reductase activity.
- C312 (= C410) mutation to A: Colorless protein, no 4Fe-4S centers, no cobalamin reductase activity.
- C315 (= C413) mutation to A: Colorless protein, no 4Fe-4S centers, no cobalamin reductase activity.
- C320 (= C417) mutation to A: Colorless protein, no 4Fe-4S centers, no cobalamin reductase activity.
7p61F Complex i from e. Coli, ddm-purified, with nadh, resting state (see paper)
26% identity, 45% coverage: 121:320/445 of query aligns to 45:281/442 of 7p61F
- binding flavin mononucleotide: G61 (= G137), G63 (= G139), K72 (= K148), N90 (= N163), D92 (≠ V165), G181 (= G238), E182 (≠ G239), N217 (≠ Q266), N218 (= N267)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G63 (= G139), G64 (= G140), A65 (= A141), F67 (= F143), K72 (= K148), L75 (≠ P151), E95 (= E168), Y178 (= Y235), E183 (= E240), F203 (≠ L257)
Sites not aligning to the query:
- binding flavin mononucleotide: 399, 400
- binding 1,4-dihydronicotinamide adenine dinucleotide: 320, 323
- binding iron/sulfur cluster: 350, 351, 353, 354, 357, 397, 398, 400
6saqB Wild-type nuoef from aquifex aeolicus bound to nadh-oh (see paper)
24% identity, 60% coverage: 113:378/445 of query aligns to 40:356/419 of 6saqB
- binding flavin mononucleotide: G64 (= G137), G66 (= G139), K75 (= K148), N91 (= N163), D93 (≠ V165), E94 (= E166), Y179 (= Y235), G182 (= G238), E183 (≠ G239), N218 (≠ Q266), N219 (= N267), T222 (= T270)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-5-[[(1~{E},3~{Z})-5-azanyl-4-oxidanyl-5-oxidanylidene-penta-1,3-dienyl]-methanoyl-amino]-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: G66 (= G139), G67 (= G140), A68 (= A141), F70 (= F143), K75 (= K148), E94 (= E166), E96 (= E168), T99 (≠ L171), E184 (= E240), Y204 (≠ L257), T318 (≠ S350)
- binding iron/sulfur cluster: P198 (vs. gap), T345 (= T367), C346 (= C368), G347 (≠ I369), Q348 (≠ R370), C349 (= C371), C352 (= C374)
Sites not aligning to the query:
7q5yC Structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus
24% identity, 60% coverage: 113:378/445 of query aligns to 41:357/419 of 7q5yC
- binding flavin mononucleotide: G65 (= G137), G67 (= G139), K76 (= K148), N92 (= N163), E95 (= E166), Y180 (= Y235), G183 (= G238), E184 (≠ G239), V218 (= V265), N219 (≠ Q266), N220 (= N267), T223 (= T270)
- binding iron/sulfur cluster: T346 (= T367), C347 (= C368), G348 (≠ I369), Q349 (≠ R370), C350 (= C371), C353 (= C374)
Sites not aligning to the query:
6hl3B Wild-type nuoef from aquifex aeolicus - oxidized form bound to NAD+ (see paper)
24% identity, 60% coverage: 113:378/445 of query aligns to 39:355/416 of 6hl3B
- binding flavin mononucleotide: G63 (= G137), G65 (= G139), K74 (= K148), N90 (= N163), D92 (≠ V165), E93 (= E166), G181 (= G238), E182 (≠ G239), E183 (= E240), V216 (= V265), N217 (≠ Q266), N218 (= N267), T221 (= T270)
- binding nicotinamide-adenine-dinucleotide: G65 (= G139), G66 (= G140), A67 (= A141), F69 (= F143), K74 (= K148), E95 (= E168), Y178 (= Y235), E183 (= E240), K200 (≠ S254), Y203 (≠ L257)
- binding iron/sulfur cluster: I179 (≠ P236), P197 (vs. gap), T344 (= T367), C345 (= C368), G346 (≠ I369), Q347 (≠ R370), C348 (= C371), C351 (= C374)
Sites not aligning to the query:
6tg9B Cryo-em structure of nadh reduced form of NAD+-dependent formate dehydrogenase from rhodobacter capsulatus (see paper)
28% identity, 23% coverage: 115:216/445 of query aligns to 124:227/493 of 6tg9B
Sites not aligning to the query:
- binding flavin mononucleotide: 254, 257, 258, 293, 294, 297
- binding 1,4-dihydronicotinamide adenine dinucleotide: 258, 259, 279, 466, 470
- binding iron/sulfur cluster: 426, 427, 428, 429, 430, 433, 470, 471, 474
6q9cB Crystal structure of aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe and nuof bound to nadh under anaerobic conditions (see paper)
24% identity, 60% coverage: 113:378/445 of query aligns to 40:356/418 of 6q9cB
- binding flavin mononucleotide: G64 (= G137), G66 (= G139), K75 (= K148), N91 (= N163), D93 (≠ V165), E94 (= E166), G182 (= G238), E183 (≠ G239), E184 (= E240), V217 (= V265), N218 (≠ Q266), N219 (= N267), T222 (= T270)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G66 (= G139), G67 (= G140), A68 (= A141), F70 (= F143), K75 (= K148), E94 (= E166), E96 (= E168), Y179 (= Y235), E184 (= E240), Y204 (≠ L257)
- binding iron/sulfur cluster: P198 (vs. gap), T345 (= T367), C346 (= C368), G347 (≠ I369), Q348 (≠ R370), C349 (= C371), C352 (= C374)
Sites not aligning to the query:
Query Sequence
>350146 FitnessBrowser__Btheta:350146
MLKTFSIGGVHPHENKLSAHQPIITAEVPAKAVILLGQHIGAPAKPIVAKGDMVKVGTKI
AEPAGFVSAAIHSSVSGKVAKIDTVVDASGYAKPAIFIDVEGDEWEETIDRSKTLVKECE
LSSEEIVKKIADAGIVGLGGACFPTQVKLCPPPSFKAECVIINAVECEPYLTADHQLMLE
HAEEVMVGVSILMKAVKVNKAFIGIENNKPDAIELMTKVASSYAGIEVVPLKVKYPQGGE
KQLIDAITKRQVASGALPISTGAVVQNVGTAFAVYEAVQKNKPLFERVITVTGKSVAKPS
NFLARIGTPMKQLIDACGGLPEDTGKVIGGGPMMGKALMNIEVPTAKGSSGILIMNQKEA
KRGEAQTCIRCAKCVSACPMGLEPYLLGALSENGDFETMEKERIMDCIECGSCQFTCPAN
RPLLDYCRLGKGKVGAMIRARQAKK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory