SitesBLAST
Comparing 350151 FitnessBrowser__Btheta:350151 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q14376 UDP-glucose 4-epimerase; Galactowaldenase; UDP-N-acetylgalactosamine 4-epimerase; UDP-GalNAc 4-epimerase; UDP-N-acetylglucosamine 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-galactose 4-epimerase; EC 5.1.3.2; EC 5.1.3.7 from Homo sapiens (Human) (see 13 papers)
49% identity, 97% coverage: 1:335/344 of query aligns to 1:337/348 of Q14376
- GYI 12:14 (= GYI 12:14) binding
- DNFHN 33:37 (≠ DNLSN 33:37) binding
- N34 (= N34) to S: in GALAC3; peripheral; nearly normal activity towards UDP-galactose; dbSNP:rs121908046
- DI 66:67 (≠ DC 60:61) binding
- F88 (= F83) binding
- G90 (≠ A85) to E: in GALAC3; 800-fold decrease in UDP-galactose epimerization activity; dbSNP:rs28940882
- K92 (= K87) binding
- V94 (= V89) to M: in GALAC3; generalized; 30-fold decrease in UDP-galactose epimerization activity; 2-fold decrease in affinity for UDP-galactose; 24% of normal activity with respect to UDP-N-acetylgalactosamine; dbSNP:rs121908047
- D103 (≠ L98) to G: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs28940883
- S132 (= S127) mutation to A: Loss of activity.
- SAT 132:134 (≠ SCT 127:129) binding
- Y157 (= Y152) active site, Proton acceptor; mutation to F: Loss of activity.
- K161 (= K156) binding
- A180 (= A175) to V: in dbSNP:rs3204468
- L183 (= L178) to P: in GALAC3; peripheral; 3-fold decrease in UDP-galactose epimerization activity; dbSNP:rs121908045
- Y185 (= Y180) binding
- YFN 185:187 (= YFN 180:182) binding
- NNL 206:208 (≠ QNL 201:203) binding
- NVF 224:226 (≠ SVF 219:221) binding
- R239 (= R234) binding
- K257 (≠ R252) to R: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; does not affect affinity for UDP-galactose; dbSNP:rs28940884
- REGD 300:303 (≠ RAGD 298:301) binding
- C307 (≠ V305) mutation to Y: No effect on activity towards UDP-galactose. Loss of activity towards UDP-N-acetylgalactosamine.
- L313 (≠ Y311) to M: in GALAC3; 6-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs3180383
- G319 (= G317) to E: in GALAC3; nearly normal activity towards UDP-galactose; mild impairment under conditions of substrate limitation; dbSNP:rs28940885
- R335 (≠ N333) to H: in GALAC3; 2-fold decrease in UDP-galactose epimerization activity; dbSNP:rs368637540
1ek6A Structure of human udp-galactose 4-epimerase complexed with nadh and udp-glucose (see paper)
49% identity, 97% coverage: 1:335/344 of query aligns to 1:337/346 of 1ek6A
- active site: S132 (= S127), A133 (≠ C128), T134 (= T129), Y157 (= Y152), K161 (= K156)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G9), G12 (= G12), Y13 (= Y13), I14 (= I14), D33 (= D33), N34 (= N34), H36 (≠ S36), N37 (= N37), D66 (= D60), I67 (≠ C61), F88 (= F83), A89 (= A84), G90 (≠ A85), K92 (= K87), S130 (= S125), S131 (= S126), S132 (= S127), Y157 (= Y152), K161 (= K156), Y185 (= Y180), P188 (= P183)
- binding uridine-5'-diphosphate-glucose: S132 (= S127), Y157 (= Y152), F186 (= F181), N187 (= N182), N207 (= N202), L208 (= L203), N224 (≠ S219), V225 (= V220), F226 (= F221), R239 (= R234), Y241 (≠ F236), V277 (= V275), R300 (= R298), D303 (= D301)
1hzjA Human udp-galactose 4-epimerase: accommodation of udp-n- acetylglucosamine within the active site (see paper)
49% identity, 97% coverage: 3:335/344 of query aligns to 2:336/345 of 1hzjA
- active site: S131 (= S127), A132 (≠ C128), T133 (= T129), Y156 (= Y152), K160 (= K156)
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G11 (= G12), Y12 (= Y13), I13 (= I14), D32 (= D33), N33 (= N34), H35 (≠ S36), N36 (= N37), D65 (= D60), I66 (≠ C61), F87 (= F83), A88 (= A84), G89 (≠ A85), K91 (= K87), S129 (= S125), S131 (= S127), Y156 (= Y152), K160 (= K156), Y184 (= Y180), P187 (= P183)
- binding uridine-diphosphate-n-acetylglucosamine: N186 (= N182), N206 (= N202), L207 (= L203), N223 (≠ S219), V224 (= V220), F225 (= F221), R238 (= R234), Y240 (≠ F236), V276 (= V275), R299 (= R298), D302 (= D301)
1i3lA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
48% identity, 97% coverage: 3:335/344 of query aligns to 2:336/347 of 1i3lA
- active site: S131 (= S127), A132 (≠ C128), T133 (= T129), Y156 (= Y152), K160 (= K156)
- binding galactose-uridine-5'-diphosphate: N186 (= N182), N206 (= N202), L207 (= L203), N223 (≠ S219), V224 (= V220), F225 (= F221), R238 (= R234), Y240 (≠ F236), V276 (= V275), R299 (= R298), D302 (= D301)
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G11 (= G12), Y12 (= Y13), I13 (= I14), D32 (= D33), N33 (= N34), H35 (≠ S36), N36 (= N37), D65 (= D60), I66 (≠ C61), F87 (= F83), A88 (= A84), G89 (≠ A85), K91 (= K87), S129 (= S125), S130 (= S126), S131 (= S127), Y156 (= Y152), K160 (= K156), Y184 (= Y180), P187 (= P183)
1i3kA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
48% identity, 97% coverage: 3:335/344 of query aligns to 2:336/347 of 1i3kA
- active site: S131 (= S127), A132 (≠ C128), T133 (= T129), Y156 (= Y152), K160 (= K156)
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G11 (= G12), Y12 (= Y13), I13 (= I14), D32 (= D33), N33 (= N34), H35 (≠ S36), N36 (= N37), D65 (= D60), I66 (≠ C61), F87 (= F83), A88 (= A84), G89 (≠ A85), K91 (= K87), S129 (= S125), S131 (= S127), Y156 (= Y152), K160 (= K156), Y184 (= Y180), P187 (= P183)
- binding uridine-5'-diphosphate-glucose: F185 (= F181), N186 (= N182), N206 (= N202), L207 (= L203), N223 (≠ S219), V224 (= V220), F225 (= F221), R238 (= R234), Y240 (≠ F236), V276 (= V275), R299 (= R298), D302 (= D301)
7xpqA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glcnac (see paper)
50% identity, 97% coverage: 5:337/344 of query aligns to 4:337/343 of 7xpqA
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G11 (= G12), Y12 (= Y13), I13 (= I14), D32 (= D33), N33 (= N34), N36 (= N37), D62 (= D60), L63 (≠ C61), F84 (= F83), A85 (= A84), G86 (≠ A85), K88 (= K87), N103 (= N102), S126 (= S125), S128 (= S127), Y152 (= Y152), K156 (= K156), Y180 (= Y180), P183 (= P183)
- binding uridine-diphosphate-n-acetylglucosamine: N182 (= N182), N202 (= N202), L203 (= L203), T219 (≠ S219), Y221 (≠ F221), R234 (= R234), Y236 (≠ F236), V275 (= V275), R298 (= R298), D301 (= D301)
7xpoA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glc (see paper)
50% identity, 97% coverage: 5:337/344 of query aligns to 4:337/344 of 7xpoA
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G11 (= G12), Y12 (= Y13), I13 (= I14), D32 (= D33), N33 (= N34), N36 (= N37), D62 (= D60), L63 (≠ C61), F84 (= F83), A85 (= A84), G86 (≠ A85), K88 (= K87), N103 (= N102), S126 (= S125), S128 (= S127), Y152 (= Y152), K156 (= K156), Y180 (= Y180), P183 (= P183)
- binding uridine-5'-diphosphate-glucose: S128 (= S127), A129 (≠ C128), F181 (= F181), N182 (= N182), N202 (= N202), L203 (= L203), T219 (≠ S219), V220 (= V220), Y221 (≠ F221), R234 (= R234), Y236 (≠ F236), V275 (= V275), R298 (= R298), D301 (= D301)
3enkA 1.9a crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei
50% identity, 97% coverage: 2:335/344 of query aligns to 4:332/340 of 3enkA
- active site: S127 (= S126), S128 (= S127), T130 (= T129), Y152 (= Y152), K156 (= K156)
- binding nicotinamide-adenine-dinucleotide: G11 (= G9), G14 (= G12), Y15 (= Y13), I16 (= I14), D35 (= D33), N36 (= N34), V38 (≠ S36), N39 (= N37), S40 (= S38), D62 (= D60), V63 (≠ C61), F84 (= F83), A85 (= A84), A86 (= A85), K88 (= K87), N103 (= N102), S126 (= S125), S128 (= S127), Y152 (= Y152), K156 (= K156), Y180 (= Y180), P183 (= P183)
- binding uridine-5'-diphosphate-glucose: T130 (= T129), N182 (= N182), N201 (≠ Q201), N202 (= N202), L203 (= L203), R219 (≠ S219), V220 (= V220), F221 (= F221), R234 (= R234), Y236 (≠ F236), V272 (= V275), R295 (= R298), D298 (= D301)
7kn1A Crystal structure of udp-glucose-4-epimerase (gale) from stenotrophomonas maltophila with bound NAD and formylated udp- arabinopyranose
48% identity, 96% coverage: 5:335/344 of query aligns to 5:330/336 of 7kn1A
- active site: S126 (= S127), Y150 (= Y152), K154 (= K156)
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), G12 (= G12), Y13 (= Y13), I14 (= I14), D33 (= D33), S34 (≠ N34), C36 (≠ S36), N37 (= N37), D60 (= D60), I61 (≠ C61), F82 (= F83), A83 (= A84), A84 (= A85), K86 (= K87), S124 (= S125), S125 (= S126), S126 (= S127), Y150 (= Y152), K154 (= K156), Y178 (= Y180), P181 (= P183)
- binding UDP-4-deoxy-4-formamido-beta-L-arabinopyranose: V88 (= V89), S126 (= S127), Y150 (= Y152), N180 (= N182), S199 (≠ Q201), N200 (= N202), L201 (= L203), Q217 (≠ S219), V218 (= V220), F219 (= F221), R232 (= R234), Y234 (≠ F236), V270 (= V275), R293 (= R298), D296 (= D301)
4lisB Crystal structure of udp-galactose-4-epimerase from aspergillus nidulans (see paper)
48% identity, 96% coverage: 5:334/344 of query aligns to 4:347/363 of 4lisB
- active site: S126 (= S127), A127 (≠ C128), T128 (= T129), Y154 (= Y152), K158 (= K156)
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), Y12 (= Y13), I13 (= I14), D32 (= D33), N33 (= N34), N36 (= N37), S37 (= S38), D59 (= D60), V60 (≠ C61), F82 (= F83), A84 (= A85), K86 (= K87), S126 (= S127), Y154 (= Y152), K158 (= K156), Y195 (= Y180), P198 (= P183)
- binding uridine-5'-diphosphate: N197 (= N182), N217 (= N202), L218 (= L203), L234 (≠ S219), V235 (= V220), F236 (= F221), R249 (= R234), V288 (= V275), R311 (= R298), D314 (= D301)
4lisA Crystal structure of udp-galactose-4-epimerase from aspergillus nidulans (see paper)
48% identity, 96% coverage: 5:334/344 of query aligns to 5:348/364 of 4lisA
- active site: S127 (= S127), A128 (≠ C128), T129 (= T129), Y155 (= Y152), K159 (= K156)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), Y13 (= Y13), I14 (= I14), D33 (= D33), N34 (= N34), N37 (= N37), S38 (= S38), D60 (= D60), V61 (≠ C61), F83 (= F83), A85 (= A85), K87 (= K87), S127 (= S127), Y155 (= Y152), K159 (= K156), Y196 (= Y180), P199 (= P183)
- binding uridine-5'-diphosphate-glucose: K87 (= K87), S127 (= S127), Y155 (= Y152), N218 (= N202), L235 (≠ S219), V236 (= V220), F237 (= F221), R250 (= R234), R312 (= R298), D315 (= D301)
6k0iA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp-glc (see paper)
50% identity, 97% coverage: 5:337/344 of query aligns to 3:330/335 of 6k0iA
- active site: S124 (= S127), A125 (≠ C128), T126 (= T129), Y149 (= Y152), K153 (= K156)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (≠ Y13), I12 (= I14), D31 (= D33), N32 (= N34), N35 (= N37), S36 (= S38), D58 (= D60), V59 (≠ C61), F80 (= F83), A81 (= A84), G82 (≠ A85), K84 (= K87), N99 (= N102), S122 (= S125), S123 (= S126), Y149 (= Y152), K153 (= K156), Y177 (= Y180), P180 (= P183)
- binding uridine-5'-diphosphate-glucose: K84 (= K87), S124 (= S127), Y149 (= Y152), F178 (= F181), N179 (= N182), A198 (≠ Q201), N199 (= N202), L200 (= L203), Q216 (≠ S219), V217 (= V220), Y218 (≠ F221), R231 (= R234), Y233 (≠ F236), V268 (= V275), R291 (= R298), D294 (= D301)
6k0hA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp-glcnac (see paper)
50% identity, 97% coverage: 5:337/344 of query aligns to 3:330/335 of 6k0hA
- active site: S124 (= S127), A125 (≠ C128), T126 (= T129), Y149 (= Y152), K153 (= K156)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (≠ Y13), I12 (= I14), D31 (= D33), N32 (= N34), G34 (≠ S36), N35 (= N37), S36 (= S38), D58 (= D60), V59 (≠ C61), F80 (= F83), A81 (= A84), G82 (≠ A85), K84 (= K87), N99 (= N102), S123 (= S126), Y149 (= Y152), K153 (= K156), Y177 (= Y180), P180 (= P183)
- binding uridine-diphosphate-n-acetylglucosamine: K84 (= K87), S124 (= S127), Y149 (= Y152), F178 (= F181), N179 (= N182), A198 (≠ Q201), N199 (= N202), L200 (= L203), Q216 (≠ S219), V217 (= V220), Y218 (≠ F221), R231 (= R234), Y233 (≠ F236), V268 (= V275), R291 (= R298), D294 (= D301)
6k0gA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp (see paper)
50% identity, 97% coverage: 5:337/344 of query aligns to 3:330/335 of 6k0gA
- active site: S124 (= S127), A125 (≠ C128), T126 (= T129), Y149 (= Y152), K153 (= K156)
- binding magnesium ion: E66 (≠ D68), H114 (= H117)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (≠ Y13), I12 (= I14), D31 (= D33), N32 (= N34), N35 (= N37), S36 (= S38), D58 (= D60), V59 (≠ C61), F80 (= F83), A81 (= A84), G82 (≠ A85), K84 (= K87), N99 (= N102), S122 (= S125), S123 (= S126), Y149 (= Y152), K153 (= K156), Y177 (= Y180), P180 (= P183)
- binding uridine-5'-diphosphate: N179 (= N182), A198 (≠ Q201), N199 (= N202), L200 (= L203), Q216 (≠ S219), V217 (= V220), Y218 (≠ F221), R231 (= R234), Y233 (≠ F236), V268 (= V275), R291 (= R298), D294 (= D301)
2udpA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
44% identity, 97% coverage: 4:337/344 of query aligns to 2:331/338 of 2udpA
- active site: S124 (= S127), A125 (≠ C128), T126 (= T129), Y149 (= Y152), K153 (= K156), M189 (≠ L192)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (= Y13), I12 (= I14), D31 (= D33), N32 (= N34), L33 (= L35), C34 (≠ S36), N35 (= N37), S36 (= S38), D58 (= D60), I59 (≠ C61), F80 (= F83), A81 (= A84), G82 (≠ A85), K84 (= K87), S122 (= S125), S124 (= S127), Y149 (= Y152), K153 (= K156), Y177 (= Y180)
- binding phenyl-uridine-5'-diphosphate: N179 (= N182), N199 (= N202), L200 (= L203), A216 (≠ S219), I217 (≠ V220), F218 (= F221), R231 (= R234), Y233 (≠ F236), V269 (= V275), R292 (= R298), D295 (= D301)
1udcA Structure of udp-galactose-4-epimerase complexed with udp-mannose (see paper)
44% identity, 97% coverage: 4:337/344 of query aligns to 2:331/338 of 1udcA
- active site: S124 (= S127), A125 (≠ C128), T126 (= T129), Y149 (= Y152), K153 (= K156), M189 (≠ L192)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (= Y13), I12 (= I14), D31 (= D33), N32 (= N34), C34 (≠ S36), N35 (= N37), S36 (= S38), D58 (= D60), I59 (≠ C61), F80 (= F83), A81 (= A84), G82 (≠ A85), K84 (= K87), S122 (= S125), Y149 (= Y152), K153 (= K156), Y177 (= Y180), P180 (= P183)
- binding uridine-5'-diphosphate-mannose: T126 (= T129), Y149 (= Y152), N179 (= N182), N199 (= N202), L200 (= L203), L215 (= L218), A216 (≠ S219), I217 (≠ V220), F218 (= F221), R231 (= R234), Y233 (≠ F236), V269 (= V275), R292 (= R298)
P09147 UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 from Escherichia coli (strain K12) (see 10 papers)
44% identity, 97% coverage: 4:337/344 of query aligns to 2:331/338 of P09147
- YI 11:12 (= YI 13:14) binding
- DNLCNS 31:36 (≠ DNLSNS 33:38) binding
- DI 58:59 (≠ DC 60:61) binding
- FAGLK 80:84 (≠ FAASK 83:87) binding
- N99 (= N102) binding
- S124 (= S127) binding ; mutation to A: No major structural changes. Catalytic efficiency is very low and affinity binding is 21% of the wild-type enzyme.; mutation to T: No major structural changes. Catalytic efficiency is about 30% of that of the wild-type enzyme, and affinity binding is similar to that of the native enzyme.
- Y149 (= Y152) active site, Proton acceptor; binding ; mutation to F: No major structural changes. Catalytic efficiency is very low and affinity binding is 12% of the wild-type enzyme.
- K153 (= K156) binding ; mutation to A: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.; mutation to M: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.
- F178 (= F181) binding
- Y299 (≠ V305) mutation to C: Loss of epimerase activity with UDP-Gal by almost 5-fold, but it results in a gain of epimerase activity with uridine diphosphate N-acetylglucosamine (UDP-GlcNAc) by 230-fold with minimal changes in its three-dimensional structure.
1udaA Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
44% identity, 97% coverage: 4:337/344 of query aligns to 2:331/338 of 1udaA
- active site: S124 (= S127), A125 (≠ C128), T126 (= T129), Y149 (= Y152), K153 (= K156), M189 (≠ L192)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (= Y13), I12 (= I14), D31 (= D33), N32 (= N34), L33 (= L35), C34 (≠ S36), N35 (= N37), S36 (= S38), D58 (= D60), I59 (≠ C61), F80 (= F83), A81 (= A84), G82 (≠ A85), K84 (= K87), S122 (= S125), Y149 (= Y152), K153 (= K156), Y177 (= Y180), P180 (= P183)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: T126 (= T129), N179 (= N182), N199 (= N202), L200 (= L203), A216 (≠ S219), I217 (≠ V220), F218 (= F221), R231 (= R234), Y233 (≠ F236), R292 (= R298), D295 (= D301), Y299 (≠ V305)
1naiA Udp-galactose 4-epimerase from escherichia coli, oxidized (see paper)
44% identity, 97% coverage: 4:337/344 of query aligns to 2:331/338 of 1naiA
- active site: S124 (= S127), A125 (≠ C128), T126 (= T129), Y149 (= Y152), K153 (= K156), M189 (≠ L192)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (= Y13), I12 (= I14), D31 (= D33), N32 (= N34), L33 (= L35), C34 (≠ S36), N35 (= N37), S36 (= S38), D58 (= D60), I59 (≠ C61), F80 (= F83), A81 (= A84), G82 (≠ A85), K84 (= K87), Y149 (= Y152), K153 (= K156), Y177 (= Y180), P180 (= P183)
- binding 1,3-propandiol: N35 (= N37), K84 (= K87), E191 (= E194), P193 (= P196)
- binding uridine-5'-diphosphate: N179 (= N182), N199 (= N202), L200 (= L203), L215 (= L218), A216 (≠ S219), R231 (= R234), Y233 (≠ F236), R292 (= R298)
1lrjA Crystal structure of e. Coli udp-galactose 4-epimerase complexed with udp-n-acetylglucosamine (see paper)
44% identity, 97% coverage: 4:337/344 of query aligns to 2:331/338 of 1lrjA
- active site: S124 (= S127), A125 (≠ C128), T126 (= T129), Y149 (= Y152), K153 (= K156), M189 (≠ L192)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (= Y13), I12 (= I14), D31 (= D33), N32 (= N34), L33 (= L35), C34 (≠ S36), N35 (= N37), S36 (= S38), D58 (= D60), I59 (≠ C61), F80 (= F83), A81 (= A84), G82 (≠ A85), K84 (= K87), Y149 (= Y152), K153 (= K156), Y177 (= Y180), P180 (= P183)
- binding uridine-diphosphate-n-acetylglucosamine: V86 (= V89), S124 (= S127), F178 (= F181), N179 (= N182), L200 (= L203), L215 (= L218), A216 (≠ S219), F218 (= F221), R231 (= R234), Y233 (≠ F236), V269 (= V275), R292 (= R298), D295 (= D301)
Query Sequence
>350151 FitnessBrowser__Btheta:350151
MKERILVTGGTGYIGSHTVVELQNSGYEVIIIDNLSNSSADVVDNIEKVSGIRPAFEKLD
CLDFAGLDAVFAKYKGIKAIIHFAASKAVGESVEKPLLYYRNNLVSLINLLELMPKHGVE
GIVFSSSCTVYGQPDELPVTEKAPIKKAESPYGNTKQINEEIIRDTIASGAPINAILLRY
FNPIGAHPTALLGELPNGVPQNLIPYLTQTAMGIREKLSVFGDDYDTPDGSCIRDFINVV
DLAKAHVIAIRRILEQKQKEKVEVFNIGTGRGVSVLELINGFEKATGVKLNYQIVGRRAG
DIEKVWANPDYANQELGWKAVETLEDTLRSAWNWQLKLRERGIQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory