Comparing 350204 FitnessBrowser__Btheta:350204 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
3iv8A N-acetylglucosamine-6-phosphate deacetylase from vibrio cholerae complexed with fructose 6-phosphate
31% identity, 96% coverage: 5:379/390 of query aligns to 5:375/379 of 3iv8A
O32445 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
31% identity, 96% coverage: 5:379/390 of query aligns to 4:374/378 of O32445
2p50A Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn (see paper)
32% identity, 95% coverage: 2:371/390 of query aligns to 4:369/382 of 2p50A
P0AF18 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Escherichia coli (strain K12) (see 2 papers)
32% identity, 95% coverage: 2:371/390 of query aligns to 4:369/382 of P0AF18
2p53A Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d273n mutant complexed with n-acetyl phosphonamidate-d-glucosamine-6- phosphate (see paper)
32% identity, 95% coverage: 2:371/390 of query aligns to 4:369/382 of 2p53A
1yrrA Crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution (see paper)
32% identity, 95% coverage: 2:371/390 of query aligns to 4:368/381 of 1yrrA
2p50B Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn (see paper)
31% identity, 95% coverage: 2:371/390 of query aligns to 4:343/356 of 2p50B
2vhlB The three-dimensional structure of the n-acetylglucosamine-6- phosphate deacetylase from bacillus subtilis (see paper)
28% identity, 95% coverage: 10:380/390 of query aligns to 11:385/393 of 2vhlB
O34450 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Bacillus subtilis (strain 168) (see paper)
28% identity, 95% coverage: 10:380/390 of query aligns to 12:386/396 of O34450
6fv4B The structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d267a mutant from mycobacterium smegmatis in complex with n-acetyl-d- glucosamine-6-phosphate (see paper)
31% identity, 91% coverage: 30:383/390 of query aligns to 23:383/385 of 6fv4B
6fv4A The structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d267a mutant from mycobacterium smegmatis in complex with n-acetyl-d- glucosamine-6-phosphate (see paper)
31% identity, 90% coverage: 30:381/390 of query aligns to 23:379/381 of 6fv4A
7nutA Crystal structure of human amdhd2 in complex with zn and glcn6p (see paper)
28% identity, 96% coverage: 7:381/390 of query aligns to 18:396/401 of 7nutA
1yrrB Crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution (see paper)
29% identity, 95% coverage: 2:371/390 of query aligns to 3:321/334 of 1yrrB
1o12A Crystal structure of n-acetylglucosamine-6-phosphate deacetylase (tm0814) from thermotoga maritima at 2.5 a resolution
29% identity, 93% coverage: 20:381/390 of query aligns to 18:360/363 of 1o12A
6fv3D Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase from mycobacterium smegmatis. (see paper)
29% identity, 90% coverage: 30:381/390 of query aligns to 21:349/350 of 6fv3D
6jkuA Crystal structure of n-acetylglucosamine-6-phosphate deacetylase from pasteurella multocida (see paper)
28% identity, 94% coverage: 5:371/390 of query aligns to 11:373/385 of 6jkuA
3mkvA Crystal structure of amidohydrolase eaj56179 (see paper)
23% identity, 96% coverage: 7:382/390 of query aligns to 8:400/414 of 3mkvA
3mkvF Crystal structure of amidohydrolase eaj56179 (see paper)
23% identity, 96% coverage: 7:382/390 of query aligns to 7:399/413 of 3mkvF
>350204 FitnessBrowser__Btheta:350204
MLTQIINGRILTPQGWLKDGSVLICDGKILEVTNSDLAVIGATVIDARGMTIVPGFVSMH
AHGGGGHDFTEATEEAFRIAATAHLKHGATGIFPTLSSTSFERIYQAVDVCEKLMKEPES
PILGLHIEGPYLNPKMAGSQYDGFLKTPDENEYVPLLEHTSCIKRWDISPELHGAHDFAK
YTRSKGIMTAVTHTEAEYDEIKAAYAVGFSHAAHFYNAMPGFHKRREYKYEGTVESVYLT
DGMTVEVIADGIHLPATILKLVYKLKGVENTCLVTDALAYAANEGNEPIDPRYIIEDGVC
KMADHSALAGSLATMDVLVRTMVKKASIPLEDAVRMASETPARLIGVSDRKGALSKGKDA
DIVILDKELNVRCVWSMGKVVPGTDRLLHK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory