Comparing 350222 FitnessBrowser__Btheta:350222 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
55% identity, 100% coverage: 1:224/224 of query aligns to 3:225/226 of 5xu1B
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
53% identity, 97% coverage: 1:218/224 of query aligns to 1:223/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
52% identity, 97% coverage: 1:218/224 of query aligns to 1:223/230 of 1l2tA
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
48% identity, 100% coverage: 1:223/224 of query aligns to 3:221/223 of 2pclA
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
43% identity, 98% coverage: 1:220/224 of query aligns to 3:222/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
43% identity, 98% coverage: 1:220/224 of query aligns to 3:222/592 of 5lj7A
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
43% identity, 98% coverage: 1:220/224 of query aligns to 4:223/650 of 5ws4A
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
42% identity, 98% coverage: 1:219/224 of query aligns to 4:222/648 of P75831
7mdyC Lolcde nucleotide-bound
42% identity, 100% coverage: 1:223/224 of query aligns to 2:225/226 of 7mdyC
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
42% identity, 100% coverage: 1:223/224 of query aligns to 5:228/233 of P75957
7arlD Lolcde in complex with lipoprotein and adp (see paper)
43% identity, 98% coverage: 1:220/224 of query aligns to 2:222/222 of 7arlD
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
42% identity, 100% coverage: 1:223/224 of query aligns to 4:227/229 of 7v8iD
8g4cB Bceabs atpgs high res tm (see paper)
41% identity, 90% coverage: 21:222/224 of query aligns to 23:225/248 of 8g4cB
Sites not aligning to the query:
7tchB Bceab e169q variant atp-bound conformation (see paper)
40% identity, 90% coverage: 21:222/224 of query aligns to 22:224/245 of 7tchB
Sites not aligning to the query:
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
39% identity, 98% coverage: 1:219/224 of query aligns to 2:218/227 of 8igqA
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
39% identity, 98% coverage: 1:219/224 of query aligns to 2:218/225 of 8iddA
A5U7B7 Cell division ATP-binding protein FtsE from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) (see 2 papers)
39% identity, 98% coverage: 1:219/224 of query aligns to 1:217/229 of A5U7B7
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
42% identity, 90% coverage: 18:219/224 of query aligns to 17:218/230 of 6z4wA
Sites not aligning to the query:
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
42% identity, 90% coverage: 18:219/224 of query aligns to 17:218/229 of 6z67B
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
42% identity, 89% coverage: 1:199/224 of query aligns to 1:199/343 of P30750
Sites not aligning to the query:
>350222 FitnessBrowser__Btheta:350222
MIQIENISKVFRTTEVETVALNHVNLEVKEGEFVAIMGPSGCGKSTLLNILGLLDNPTEG
SYRLLGEEVAGLKEKERTGVRKGKLGFVFQSFNLIDELNVFENVELPLTYLGIKSSERRR
MVEDILKRMNISHRAKHFPQQLSGGQQQRVAIARAVVTNPKLILADEPTGNLDSKNGAEV
MNLLTELNKEGTTIIMVTHSQHDASFAHRTVHLFDGSVVASVTA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory