SitesBLAST
Comparing 350232 FitnessBrowser__Btheta:350232 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P33221 Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; GAR transformylase T; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 6.3.1.21 from Escherichia coli (strain K12) (see 5 papers)
52% identity, 99% coverage: 3:387/388 of query aligns to 14:390/392 of P33221
- EL 22:23 (= EL 11:12) binding
- E82 (= E71) binding
- R114 (= R103) binding
- K155 (= K144) binding
- SSGKGQ 160:165 (= SSGKGQ 149:154) binding
- G162 (= G151) mutation to I: Strong decrease in the reaction rate for the conversion of formate to FGAR and in the affinity for formate. 3- and 2-fold decrease in the affinity for ATP and GAR, respectively.
- K179 (≠ E168) modified: N6-acetyllysine
- EGVV 195:198 (≠ EEFI 184:187) binding
- E203 (= E192) binding
- E267 (= E257) binding
- E279 (= E270) binding
- D286 (= D277) binding
- K355 (= K349) binding
- RR 362:363 (= RR 356:357) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1kjiA Crystal structure of glycinamide ribonucleotide transformylase in complex with mg-amppcp (see paper)
52% identity, 99% coverage: 3:387/388 of query aligns to 13:387/389 of 1kjiA
- active site: E114 (≠ K104), K154 (= K144), S159 (= S149), G161 (= G151), E264 (= E257), E276 (= E270), D283 (= D277), T284 (= T278), R360 (= R357)
- binding phosphomethylphosphonic acid adenylate ester: R113 (= R103), I152 (≠ V142), K154 (= K144), S159 (= S149), S160 (= S150), G161 (= G151), Q164 (= Q154), E192 (= E184), V195 (≠ I187), E200 (= E192), Q222 (= Q215), E264 (= E257), F266 (= F259), E276 (= E270)
- binding magnesium ion: E264 (= E257), E276 (= E270)
1ez1A Structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg, amppnp, and gar (see paper)
52% identity, 99% coverage: 3:387/388 of query aligns to 13:387/389 of 1ez1A
- active site: E114 (≠ K104), K154 (= K144), S159 (= S149), G161 (= G151), E264 (= E257), E276 (= E270), D283 (= D277), T284 (= T278), R360 (= R357)
- binding phosphoaminophosphonic acid-adenylate ester: R113 (= R103), I152 (≠ V142), K154 (= K144), S159 (= S149), S160 (= S150), G161 (= G151), E192 (= E184), V194 (≠ F186), V195 (≠ I187), F197 (= F189), E200 (= E192), Q222 (= Q215), E264 (= E257), F266 (= F259), E276 (= E270)
- binding glycinamide ribonucleotide: G20 (= G10), E21 (= E11), L22 (= L12), E81 (= E71), I82 (= I72), S160 (= S150), D283 (= D277), K352 (= K349), R359 (= R356), R360 (= R357)
- binding magnesium ion: E264 (= E257), E276 (= E270)
1eyzA Structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg and amppnp (see paper)
52% identity, 99% coverage: 3:387/388 of query aligns to 13:387/389 of 1eyzA
- active site: E114 (≠ K104), K154 (= K144), S159 (= S149), G161 (= G151), E264 (= E257), E276 (= E270), D283 (= D277), T284 (= T278), R360 (= R357)
- binding phosphoaminophosphonic acid-adenylate ester: R113 (= R103), I152 (≠ V142), K154 (= K144), S159 (= S149), S160 (= S150), G161 (= G151), Q164 (= Q154), E192 (= E184), V195 (≠ I187), F197 (= F189), E200 (= E192), E264 (= E257), F266 (= F259), E276 (= E270)
- binding magnesium ion: E264 (= E257), E276 (= E270)
1kjjA Crystal structure of glycniamide ribonucleotide transformylase in complex with mg-atp-gamma-s (see paper)
52% identity, 99% coverage: 3:387/388 of query aligns to 13:384/386 of 1kjjA
- active site: E114 (≠ K104), K154 (= K144), S159 (= S149), G161 (= G151), E261 (= E257), E273 (= E270), D280 (= D277), T281 (= T278), R357 (= R357)
- binding phosphothiophosphoric acid-adenylate ester: R113 (= R103), I152 (≠ V142), K154 (= K144), S159 (= S149), S160 (= S150), G161 (= G151), Q164 (= Q154), E189 (= E184), V192 (≠ I187), E197 (= E192), Q219 (= Q215), E261 (= E257), F263 (= F259), E273 (= E270)
- binding magnesium ion: E261 (= E257), E273 (= E270)
1kj8A Crystal structure of purt-encoded glycinamide ribonucleotide transformylase in complex with mg-atp and gar (see paper)
52% identity, 99% coverage: 3:387/388 of query aligns to 13:384/386 of 1kj8A
- active site: E114 (≠ K104), K154 (= K144), S159 (= S149), G161 (= G151), E261 (= E257), E273 (= E270), D280 (= D277), T281 (= T278), R357 (= R357)
- binding adenosine-5'-triphosphate: R113 (= R103), I152 (≠ V142), K154 (= K144), S159 (= S149), S160 (= S150), G161 (= G151), Q164 (= Q154), E189 (= E184), V192 (≠ I187), F194 (= F189), E197 (= E192), Q219 (= Q215), G222 (= G218), E261 (= E257), F263 (= F259), E273 (= E270)
- binding glycinamide ribonucleotide: G20 (= G10), E21 (= E11), L22 (= L12), E81 (= E71), I82 (= I72), S160 (= S150), D280 (= D277), K349 (= K349), R356 (= R356)
- binding magnesium ion: E261 (= E257), E273 (= E270)
1kjqA Crystal structure of glycinamide ribonucleotide transformylase in complex with mg-adp (see paper)
51% identity, 99% coverage: 3:387/388 of query aligns to 13:386/388 of 1kjqA
- active site: E114 (≠ K104), K154 (= K144), E263 (= E257), E275 (= E270), D282 (= D277), T283 (= T278), R359 (= R357)
- binding adenosine-5'-diphosphate: R113 (= R103), I152 (≠ V142), K154 (= K144), E191 (= E184), V193 (≠ F186), V194 (≠ I187), F196 (= F189), E199 (= E192), Q221 (= Q215), F265 (= F259), E275 (= E270)
- binding magnesium ion: E263 (= E257), E275 (= E270)
O58056 Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 6.3.1.21 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
45% identity, 99% coverage: 2:387/388 of query aligns to 17:410/430 of O58056
2dwcB Crystal structure of probable phosphoribosylglycinamide formyl transferase from pyrococcus horikoshii ot3 complexed with adp
44% identity, 99% coverage: 2:387/388 of query aligns to 19:399/409 of 2dwcB
- active site: E265 (= E257), E277 (= E270), D284 (= D277), T285 (= T278), R372 (= R357)
- binding adenosine-5'-diphosphate: R120 (= R103), H159 (≠ V142), K161 (= K144), H190 (≠ F186), I191 (= I187), F193 (= F189), E196 (= E192), F267 (= F259), E277 (= E270)
3ax6A Crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermotoga maritima
28% identity, 94% coverage: 18:380/388 of query aligns to 18:350/360 of 3ax6A
- active site: E231 (= E257), E244 (= E270), N251 (≠ D277), S252 (≠ T278), K330 (≠ R357)
- binding adenosine-5'-diphosphate: K101 (≠ R103), V136 (= V142), K138 (= K144), E164 (= E184), F166 (= F186), V167 (≠ I187), E172 (= E192), F233 (= F259), N243 (≠ S269)
3r5hA Crystal structure of adp-air complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
25% identity, 98% coverage: 1:381/388 of query aligns to 1:369/383 of 3r5hA
- binding adenosine-5'-diphosphate: R107 (= R103), K147 (= K144), Q158 (= Q154), W184 (≠ F186), V185 (≠ I187), F187 (= F189), E190 (= E192), N216 (≠ G218), F257 (= F259), N267 (≠ S269), E268 (= E270)
- binding 5-aminoimidazole ribonucleotide: G17 (vs. gap), Q18 (≠ E11), L19 (= L12), E76 (= E71), Y153 (vs. gap), R272 (= R274), K340 (= K349), R347 (= R356)
3q2oB Crystal structure of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
25% identity, 98% coverage: 1:381/388 of query aligns to 1:369/377 of 3q2oB
4dlkA Crystal structure of atp-ca++ complex of purk: n5- carboxyaminoimidazole ribonucleotide synthetase (see paper)
25% identity, 98% coverage: 1:381/388 of query aligns to 1:369/380 of 4dlkA
- active site: Y153 (vs. gap), G155 (= G151), E255 (= E257), E268 (= E270), N275 (≠ D277), S276 (≠ T278), K348 (≠ R357)
- binding adenosine-5'-triphosphate: E76 (= E71), F77 (≠ I72), R107 (= R103), K147 (= K144), Y153 (vs. gap), D154 (≠ S150), G155 (= G151), Q158 (= Q154), W184 (≠ F186), V185 (≠ I187), F187 (= F189), E190 (= E192), E255 (= E257), F257 (= F259), N267 (≠ S269), E268 (= E270), R272 (= R274), H274 (= H276), N275 (≠ D277), K340 (= K349), R347 (= R356), K348 (≠ R357)
- binding calcium ion: E255 (= E257), E268 (= E270)
- binding phosphate ion: Q47 (= Q40), A49 (= A42)
3v4sB Crystal structure of adp-atp complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
25% identity, 98% coverage: 1:381/388 of query aligns to 2:370/381 of 3v4sB
- binding adenosine-5'-triphosphate: R108 (= R103), K148 (= K144), Y154 (vs. gap), D155 (≠ S150), G156 (= G151), Q159 (= Q154), E183 (= E184), W185 (≠ F186), V186 (≠ I187), F188 (= F189), E191 (= E192), H214 (≠ Q215), N217 (≠ G218), E256 (= E257), F258 (= F259), E269 (= E270)
- binding carbonate ion: R273 (= R274), H275 (= H276), N276 (≠ D277)
- binding magnesium ion: T105 (= T100), E111 (≠ I106), E256 (= E257), E269 (= E270), L270 (= L271)
3v4sA Crystal structure of adp-atp complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
25% identity, 96% coverage: 11:381/388 of query aligns to 17:368/380 of 3v4sA
- binding adenosine-5'-diphosphate: R106 (= R103), K146 (= K144), Y152 (vs. gap), G154 (= G151), Q157 (= Q154), W183 (≠ F186), V184 (≠ I187), E189 (= E192), N215 (≠ G218), F256 (= F259), N266 (≠ S269), E267 (= E270)
- binding carbonate ion: R271 (= R274), H273 (= H276), N274 (≠ D277)
3aw8A Crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermus thermophilus hb8
31% identity, 92% coverage: 30:385/388 of query aligns to 28:354/360 of 3aw8A
- active site: E240 (= E257), E252 (= E270), N259 (≠ D277), S260 (≠ T278), K329 (≠ R357)
- binding adenosine monophosphate: L135 (≠ V142), K137 (= K144), Q142 (= Q154), F168 (= F186), V169 (≠ I187), E174 (= E192), H197 (≠ Q215), F242 (= F259), E252 (= E270)
3orqA Crystal structure of n5-carboxyaminoimidazole synthetase from staphylococcus aureus complexed with adp (see paper)
25% identity, 90% coverage: 11:359/388 of query aligns to 21:352/373 of 3orqA
- active site: Y156 (vs. gap), E256 (= E257), E269 (= E270), N276 (≠ D277), S277 (≠ T278), K350 (≠ R357)
- binding adenosine-5'-diphosphate: R110 (= R103), K150 (= K144), Y156 (vs. gap), D157 (≠ S150), Q161 (= Q154), E185 (= E184), Y187 (≠ F186), L188 (≠ I187), I190 (≠ F189), E193 (= E192), H216 (≠ Q215), F258 (= F259), E269 (= E270)
- binding magnesium ion: E256 (= E257), E269 (= E270)
- binding pyrophosphate 2-: Y156 (vs. gap), K342 (= K349), R349 (= R356)
3k5iA Crystal structure of n5-carboxyaminoimidazole synthase from aspergillus clavatus in complex with adp and 5-aminoimadazole ribonucleotide (see paper)
27% identity, 78% coverage: 66:366/388 of query aligns to 68:362/381 of 3k5iA
- active site: E254 (= E257), E267 (= E270), N274 (≠ D277), S275 (≠ T278), K353 (≠ R357)
- binding adenosine-5'-diphosphate: K104 (= K104), K146 (= K144), Y152 (≠ S149), D153 (≠ S150), G154 (= G151), W183 (≠ F186), A184 (≠ I187), F186 (= F189), E189 (= E192), Q211 (= Q215), S214 (≠ G218), E267 (= E270)
- binding 5-aminoimidazole ribonucleotide: E73 (= E71), I74 (= I72), Y152 (≠ S149), D153 (≠ S150), R155 (≠ K152), R271 (= R274), K345 (= K349), R352 (= R356)
- binding magnesium ion: E254 (= E257), E267 (= E270)
Sites not aligning to the query:
3k5hA Crystal structure of carboxyaminoimidazole ribonucleotide synthase from asperigillus clavatus complexed with atp (see paper)
27% identity, 78% coverage: 66:366/388 of query aligns to 68:362/382 of 3k5hA
- active site: Y152 (≠ S149), G154 (= G151), E254 (= E257), E267 (= E270), N274 (≠ D277), S275 (≠ T278), K353 (≠ R357)
- binding adenosine-5'-triphosphate: K104 (= K104), K146 (= K144), Y152 (≠ S149), D153 (≠ S150), G154 (= G151), N157 (≠ Q154), E181 (= E184), W183 (≠ F186), A184 (≠ I187), F186 (= F189), E189 (= E192), E254 (= E257), F256 (= F259), E267 (= E270)
- binding magnesium ion: E254 (= E257), E267 (= E270)
5jqwA The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with adp
24% identity, 77% coverage: 3:302/388 of query aligns to 2:290/365 of 5jqwA
- active site: Y144 (≠ S149), G146 (= G151), E247 (= E257), E259 (= E270), N266 (≠ D277), S267 (≠ T278)
- binding adenosine-5'-diphosphate: R98 (= R103), K138 (= K144), G143 (≠ S148), Y144 (≠ S149), D145 (≠ S150), G146 (= G151), V178 (≠ I187), E183 (= E192), H206 (≠ Q215), F249 (= F259), E259 (= E270)
Sites not aligning to the query:
Query Sequence
>350232 FitnessBrowser__Btheta:350232
MKKILLLGSGELGKEFVISAQRKGQHVIACDSYAGAPAMQVADEFEVFDMLDGEALERVV
EKHHPDIIVPEIEAIRTERLYDFEKEGIQVVPSARAVNFTMNRKAIRDLAAKELGLKTAN
YFYAKTLDELKEAAAKIGFPCVVKPLMSSSGKGQSLVKSADELEHAWEYGCSGSRGDIRE
LIIEEFIKFDSEITLLTVTQKNGPTLFCPPIGHVQKGGDYRESFQPAHIDPAHLKEAEEM
AEKVTRALTGAGLWGVEFFLSHENGVYFSELSPRPHDTGMVTLAGTQNLNEFELHLRAVL
GLPIPGIKQERIGASAVILSPIASQERPQYRGMEEVTKEEDTYLRIFGKPFTRVNRRMGV
VLCYAPLNSDLDALRDKAKRIAEKVEVY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory