Comparing 350263 BT0735 aspartate decarboxylase AsdA (NCBI ptt file) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q93QX0 Bifunctional aspartate aminotransferase and L-aspartate beta-decarboxylase; Aspartate 4-decarboxylase; ASD; AsdA; EC 2.6.1.1; EC 4.1.1.12 from Comamonas testosteroni (Pseudomonas testosteroni) (see paper)
46% identity, 95% coverage: 25:555/557 of query aligns to 1:525/533 of Q93QX0
2zy4F Dodecameric l-aspartate beta-decarboxylase (see paper)
46% identity, 94% coverage: 31:555/557 of query aligns to 1:520/535 of 2zy4F
Q53IZ1 Bifunctional aspartate aminotransferase and L-aspartate beta-decarboxylase; Aspartate 4-decarboxylase; Asd; AsdP; EC 2.6.1.1; EC 4.1.1.12 from Pseudomonas sp. (see paper)
45% identity, 96% coverage: 25:556/557 of query aligns to 1:524/531 of Q53IZ1
2zy2A Dodecameric l-aspartate beta-decarboxylase (see paper)
46% identity, 93% coverage: 37:556/557 of query aligns to 1:513/521 of 2zy2A
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
27% identity, 29% coverage: 193:354/557 of query aligns to 93:242/382 of 1b5oA
5yhvB Crystal structure of an aminotransferase from mycobacterium tuberculosis
27% identity, 25% coverage: 216:354/557 of query aligns to 110:241/387 of 5yhvB
Sites not aligning to the query:
5yhvA Crystal structure of an aminotransferase from mycobacterium tuberculosis
27% identity, 25% coverage: 216:354/557 of query aligns to 117:248/394 of 5yhvA
Sites not aligning to the query:
P96847 Valine--pyruvate aminotransferase; Alanine--valine transaminase; EC 2.6.1.66 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
27% identity, 25% coverage: 216:354/557 of query aligns to 111:242/388 of P96847
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
27% identity, 29% coverage: 193:354/557 of query aligns to 93:242/382 of 1gc4A
Sites not aligning to the query:
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
27% identity, 29% coverage: 193:354/557 of query aligns to 93:242/382 of 1gc3A
Sites not aligning to the query:
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
27% identity, 29% coverage: 193:354/557 of query aligns to 93:242/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
27% identity, 29% coverage: 193:354/557 of query aligns to 93:242/382 of 1bjwA
Sites not aligning to the query:
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
27% identity, 29% coverage: 193:354/557 of query aligns to 93:242/385 of Q56232
Sites not aligning to the query:
6f77A Crystal structure of the prephenate aminotransferase from rhizobium meliloti (see paper)
24% identity, 39% coverage: 200:419/557 of query aligns to 96:317/399 of 6f77A
Q02635 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.79 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
24% identity, 39% coverage: 200:419/557 of query aligns to 97:318/400 of Q02635
Sites not aligning to the query:
5wmhA Arabidopsis thaliana prephenate aminotransferase (see paper)
27% identity, 25% coverage: 267:407/557 of query aligns to 153:300/399 of 5wmhA
Sites not aligning to the query:
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
25% identity, 31% coverage: 193:365/557 of query aligns to 97:261/402 of P14909
Sites not aligning to the query:
5wmiA Arabidopsis thaliana prephenate aminotransferase mutant- t84v (see paper)
27% identity, 25% coverage: 267:407/557 of query aligns to 153:300/402 of 5wmiA
Sites not aligning to the query:
1w7nA Crystal structure of human kynurenine aminotransferase i in pmp form (see paper)
24% identity, 41% coverage: 138:365/557 of query aligns to 47:259/415 of 1w7nA
1w7mA Crystal structure of human kynurenine aminotransferase i in complex with l-phe (see paper)
24% identity, 41% coverage: 138:365/557 of query aligns to 47:259/415 of 1w7mA
Sites not aligning to the query:
>350263 BT0735 aspartate decarboxylase AsdA (NCBI ptt file)
MYRKSKLSIKTIRTIMEKKTTGTVITKNFAKKMETISPFELKNKLIEMADESIKKMAHTM
LNAGRGNPNWIATEPREAFFLLGKFGLCECRRVQSLEEGIAGIPQQEGIAARFEAFLKEN
EKEAGARLLKETYNYMLMEHAADPDRLVHEWAESVIGDQYPVPDRILHFTELIVQDYLAQ
EMCDRRPPKGTFDLFATEGGTAAMCYVFDSLQENFLLNQGDSIALMIPVFTPYIEIPELR
RYQFDVTEISADQMTPDGLHTWQYKDEDIDKLKNPQIKALFITNPSNPPSYALSPETAAR
IVNIVKNDNPNLMIITDDVYGTFIPHFRSLMAELPHNTLCVYSFSKYFGATGWRNAVIAL
HEDNIYDKMIARLSEEQTAILNKRYASLSLHPEKMKFIDRMVADSRQIALNHTAGLSLPQ
QMQMSLFAAFSLLDKEDRYKAKMQEIIHRRLHALWDSTGFTLIEDPLRAGYYSEIDMLVW
AKKFYGDEFADYLQKTYNPLDVVFRLANETSLVLLNGGGFAGPKWSVRVSLANLNEADYV
KIGQSIKRVLDEYAENR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory