Comparing 350270 FitnessBrowser__Btheta:350270 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A786 Aspartate carbamoyltransferase catalytic subunit; Aspartate transcarbamylase; ATCase; EC 2.1.3.2 from Escherichia coli (strain K12) (see 4 papers)
53% identity, 95% coverage: 4:300/313 of query aligns to 8:305/311 of P0A786
Sites not aligning to the query:
2ipoA E. Coli aspartate transcarbamoylase complexed with n-phosphonacetyl-l- asparagine (see paper)
53% identity, 95% coverage: 4:300/313 of query aligns to 7:304/310 of 2ipoA
2h3eA Structure of wild-type e. Coli aspartate transcarbamoylase in the presence of n-phosphonacetyl-l-isoasparagine at 2.3a resolution (see paper)
53% identity, 95% coverage: 4:300/313 of query aligns to 7:304/310 of 2h3eA
2fzkA The structure of wild-type e. Coli aspartate transcarbamoylase in complex with novel t state inhibitors at 2.50 resolution (see paper)
53% identity, 95% coverage: 4:300/313 of query aligns to 7:304/310 of 2fzkA
2fzgA The structure of wild-type e. Coli aspartate transcarbamoylase in complex with novel t state inhibitors at 2.25 resolution (see paper)
53% identity, 95% coverage: 4:300/313 of query aligns to 7:304/310 of 2fzgA
2fzcA The structure of wild-type e. Coli aspartate transcarbamoylase in complex with novel t state inhibitors at 2.10 resolution (see paper)
53% identity, 95% coverage: 4:300/313 of query aligns to 7:304/310 of 2fzcA
2airA T-state active site of aspartate transcarbamylase:crystal structure of the carbamyl phosphate and l-alanosine ligated enzyme (see paper)
53% identity, 95% coverage: 4:300/313 of query aligns to 7:304/310 of 2airA
1za2A Structure of wild-type e. Coli aspartate transcarbamoylase in the presence of ctp, carbamoyl phosphate at 2.50 a resolution (see paper)
53% identity, 95% coverage: 4:300/313 of query aligns to 7:304/310 of 1za2A
1r0cA Products in the t state of aspartate transcarbamylase: crystal structure of the phosphate and n-carbamyl-l-aspartate ligated enzyme (see paper)
53% identity, 95% coverage: 4:300/313 of query aligns to 7:304/310 of 1r0cA
1r0bA Aspartate transcarbamylase (atcase) of escherichia coli: a new crystalline r state bound to pala, or to product analogues phosphate and citrate (see paper)
53% identity, 95% coverage: 4:300/313 of query aligns to 7:304/310 of 1r0bA
2at1A Crystal structures of phosphonoacetamide ligated t and phosphonoacetamide and malonate ligated r states of aspartate carbamoyltransferase at 2.8-angstroms resolution and neutral ph (see paper)
53% identity, 95% coverage: 4:300/313 of query aligns to 7:304/310 of 2at1A
1at1A Crystal structures of phosphonoacetamide ligated t and phosphonoacetamide and malonate ligated r states of aspartate carbamoyltransferase at 2.8-angstroms resolution and neutral p H (see paper)
53% identity, 95% coverage: 4:300/313 of query aligns to 7:304/310 of 1at1A
2hseA Structure of d236a e. Coli aspartate transcarbamoylase in the presence of phosphonoacetamide and l-aspartate at 2.60 a resolution
53% identity, 95% coverage: 4:300/313 of query aligns to 7:304/310 of 2hseA
2a0fA Structure of d236a mutant e. Coli aspartate transcarbamoylase in presence of phosphonoacetamide at 2.90 a resolution (see paper)
53% identity, 95% coverage: 4:300/313 of query aligns to 7:304/310 of 2a0fA
5vmqC Structure of the r105a mutant catalytic trimer of escherichia coli aspartate transcarbamoylase at 2.0-a resolution (see paper)
53% identity, 95% coverage: 4:300/313 of query aligns to 7:304/309 of 5vmqC
1acmA Arginine 54 in the active site of escherichia coli aspartate transcarbamoylase is critical for catalysis: a site-specific mutagenesis, nmr and x-ray crystallography study (see paper)
52% identity, 95% coverage: 4:300/313 of query aligns to 7:304/310 of 1acmA
1ml4A The pala-liganded aspartate transcarbamoylase catalytic subunit from pyrococcus abyssi (see paper)
49% identity, 96% coverage: 1:302/313 of query aligns to 2:306/307 of 1ml4A
4eknB Structure of the catalytic chain of methanococcus jannaschii aspartate transcarbamoylase in a hexagonal crystal form (see paper)
50% identity, 95% coverage: 4:300/313 of query aligns to 2:300/304 of 4eknB
7zidB Crystal structure of truncated aspartate transcarbamoylase from plasmodium falciparum in complex with bda-14 (see paper)
43% identity, 95% coverage: 1:296/313 of query aligns to 9:321/331 of 7zidB
7zeaB Crystal structure of truncated aspartate transcarbamoylase from plasmodium falciparum with bound inhibitor o-benzylhydroxylamine (see paper)
43% identity, 95% coverage: 1:296/313 of query aligns to 18:330/346 of 7zeaB
>350270 FitnessBrowser__Btheta:350270
MENRSLVTIAEHSKEKILYMLEMAKQFEMNPNRRLLQGKVVATLFFEPSTRTRLSFETAA
NRLGARVIGFTDPKATSSSKGETLKDTIMMVSSYADIIVMRHYLEGAARYASEVAPVPIV
NAGDGANQHPSQTMLDLYSIYKTQGTLENLNIFLVGDLKYGRTVHSLLMAMRHFNPTFHF
IAPDELKMPEEYKLYCKEHQIKYIEHTEFTEEIIADADILYMTRVQRERFTDLMEYERVK
NVYILRNKMLENTRPNLRILHPLPRVNEIAYDVDNNPKAYYFQQAQNGLYAREAILCDVL
GITLEDVKNDILL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory