Comparing 350295 FitnessBrowser__Btheta:350295 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7pi1DDD Aminodeoxychorismate synthase component 1
30% identity, 76% coverage: 77:327/330 of query aligns to 189:448/459 of 7pi1DDD
Sites not aligning to the query:
P28820 Aminodeoxychorismate synthase component 1; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 1; EC 2.6.1.85 from Bacillus subtilis (strain 168) (see paper)
30% identity, 76% coverage: 77:327/330 of query aligns to 196:455/470 of P28820
7bvdA Anthranilate synthase component i (trpe)[mycolicibacterium smegmatis]
29% identity, 80% coverage: 63:325/330 of query aligns to 210:483/499 of 7bvdA
Sites not aligning to the query:
A0QX93 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
29% identity, 80% coverage: 63:325/330 of query aligns to 231:508/524 of A0QX93
5cwaA Structure of anthranilate synthase component i (trpe) from mycobacterium tuberculosis with inhibitor bound (see paper)
29% identity, 79% coverage: 64:325/330 of query aligns to 211:487/505 of 5cwaA
O94582 Probable anthranilate synthase component 1; Anthranilate synthase component I; EC 4.1.3.27 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 85% coverage: 47:325/330 of query aligns to 176:467/489 of O94582
Sites not aligning to the query:
P05041 Aminodeoxychorismate synthase component 1; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 1; EC 2.6.1.85 from Escherichia coli (strain K12) (see 4 papers)
30% identity, 74% coverage: 81:325/330 of query aligns to 191:444/453 of P05041
Sites not aligning to the query:
1k0eA The crystal structure of aminodeoxychorismate synthase from formate grown crystals (see paper)
29% identity, 74% coverage: 81:325/330 of query aligns to 189:428/437 of 1k0eA
Sites not aligning to the query:
P00898 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
30% identity, 75% coverage: 78:325/330 of query aligns to 240:503/520 of P00898
Sites not aligning to the query:
1i1qA Structure of the cooperative allosteric anthranilate synthase from salmonella typhimurium (see paper)
30% identity, 75% coverage: 78:325/330 of query aligns to 236:499/512 of 1i1qA
Sites not aligning to the query:
1i7qA Anthranilate synthase from s. Marcescens (see paper)
30% identity, 68% coverage: 103:325/330 of query aligns to 268:500/517 of 1i7qA
Sites not aligning to the query:
1i7sA Anthranilate synthase from serratia marcescens in complex with its end product inhibitor l-tryptophan (see paper)
30% identity, 68% coverage: 103:325/330 of query aligns to 262:494/511 of 1i7sA
Sites not aligning to the query:
P00897 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Serratia marcescens (see paper)
30% identity, 68% coverage: 103:325/330 of query aligns to 270:502/519 of P00897
Sites not aligning to the query:
1k0gB The crystal structure of aminodeoxychorismate synthase from phosphate grown crystals (see paper)
28% identity, 74% coverage: 81:325/330 of query aligns to 191:408/415 of 1k0gB
Sites not aligning to the query:
P32068 Anthranilate synthase alpha subunit 1, chloroplastic; Anthranilate synthase component 1-1; Anthranilate synthase component I-1; Protein A-METHYL TRYPTOPHAN RESISTANT 1; Protein JASMONATE-INDUCED DEFECTIVE LATERAL ROOT 1; Protein TRYPTOPHAN BIOSYNTHESIS 5; Protein WEAK ETHYLENE INSENSITIVE 2; EC 4.1.3.27 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 74% coverage: 81:325/330 of query aligns to 307:578/595 of P32068
8hx9A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae with chorismate (see paper)
32% identity, 74% coverage: 81:325/330 of query aligns to 370:624/632 of 8hx9A
Sites not aligning to the query:
8hx8A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate (see paper)
32% identity, 74% coverage: 81:325/330 of query aligns to 409:663/673 of 8hx8A
Sites not aligning to the query:
1k0gA The crystal structure of aminodeoxychorismate synthase from phosphate grown crystals (see paper)
32% identity, 55% coverage: 143:325/330 of query aligns to 244:411/420 of 1k0gA
Sites not aligning to the query:
Q94GF1 Anthranilate synthase alpha subunit 1, chloroplastic; OsASA1; EC 4.1.3.27 from Oryza sativa subsp. japonica (Rice) (see paper)
28% identity, 75% coverage: 79:325/330 of query aligns to 287:560/577 of Q94GF1
5jy9B An iron-bound structure of the salicylate synthase irp9 (see paper)
25% identity, 65% coverage: 111:325/330 of query aligns to 207:415/424 of 5jy9B
Sites not aligning to the query:
>350295 FitnessBrowser__Btheta:350295
MQLYTREETIRKINHLGQSCRPFIFIINYLQDASYIEEVASVDPSEVVYNLNGFTNQSSS
KDVLSCFEEPVHWNSYPESFDSYRRSFDIVQRNIFAGNSFLTNLTCRTPIETNLSLKDIF
FRSKAMYKLWVRDQFTVFSPEIFVRIQQGKISSYPMKGTLDASLPSAVRQLMDDPKEAAE
HATIVDLIRNDLSIVADRVSVSRYRYIDKLQTNRGTILQTSSEIQGTLPDNYRENLGHIL
FKLLPAGSITGAPKKKTMQIISEAETYERGFYTGVMGYFDGSSLDSAVMIRFVEQEGDRM
YFKSGGGITCRSEVESEYHEMKQKVYVPIY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory