SitesBLAST
Comparing 350313 FitnessBrowser__Btheta:350313 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A0R079 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
29% identity, 91% coverage: 21:474/500 of query aligns to 2:459/478 of A0R079
- K14 (≠ Q33) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
3ng0A Crystal structure of glutamine synthetase from synechocystis sp. Pcc 6803
28% identity, 89% coverage: 24:467/500 of query aligns to 2:439/465 of 3ng0A
- active site: D51 (= D75), E130 (= E146), E132 (≠ Q148), E213 (= E206), E221 (= E221), H270 (= H270), R340 (= R338), E359 (= E376), R361 (= R378)
- binding phosphoaminophosphonic acid-adenylate ester: Y126 (≠ V142), E130 (= E146), K209 (≠ Y202), I224 (≠ F224), F226 (≠ P226), H272 (= H272), S274 (≠ R274), R340 (= R338), R345 (= R343), R357 (≠ T374)
- binding manganese (ii) ion: E130 (= E146), E132 (≠ Q148), E213 (= E206), E221 (= E221), H270 (= H270), E359 (= E376), R361 (= R378)
P77961 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Synechocystis sp. (strain PCC 6803 / Kazusa)
28% identity, 89% coverage: 24:467/500 of query aligns to 4:447/473 of P77961
- E134 (≠ Q148) binding
- E215 (= E206) binding
- E223 (= E221) binding
- E361 (= E376) binding
P12425 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I alpha; GSI alpha; EC 6.3.1.2 from Bacillus subtilis (strain 168) (see 5 papers)
28% identity, 85% coverage: 21:443/500 of query aligns to 2:397/444 of P12425
- G59 (≠ P81) mutation to R: Unable to form stable complex with TnrA. In the presence of glutamine, this mutant derepresses amtB-lacZ fusion and glnRA-lacZ fusion.
- R62 (≠ E84) Important for inhibition by glutamine; mutation to A: Highly resistant to inhibition by glutamine and AMP. Regulation by TnrA and GlnR is abolished. Only small differences (less than 2-fold) in its steady-state kinetic constants compared with the wild-type. Similar sensitivity to Met-Sox that compared to the wild-ytpe.
- E132 (= E152) binding
- E134 (= E154) binding
- E189 (= E206) binding
- V190 (= V207) mutation to A: Unable to form stable complex with TnrA. In the presence of glutamine, this mutant partially relieves expression of the glnRA-lacZ fusion, but has no effect on the TnrA-dependent regulation of amtB-lacZ fusion. Resistant to inhibition by MetSox.
- E196 (= E221) binding
- G241 (= G266) binding
- H245 (= H270) binding
- G302 (≠ H324) mutation to E: Unable to form stable complex with TnrA. In the presence of glutamine, amtB-lacZ fusion is only 4-fold regulated by TnrA, whereas glnRA-lacZ fusion is derepressed. This mutant retains enzymatic specific activity with a 2-fold decrease of the affinity for glutamate and glutamine compared to the wild-type. Slightly less sensitive to inhibition by glutamine.
- E304 (= E326) mutation to A: Highly resistant to Met-Sox inhibition. 8- and 2-fold increase of the affinity for glutamate and ATP, respectively. Strong decrease of the affinity for ammonium.
- P306 (= P328) mutation to H: Unable to form stable complex with TnrA. In the presence of glutamine, this mutant completely derepresses glnRA-lacZ fusion, whereas amtB-lacZ fusion expression is only partially derepresses.
- E333 (= E376) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 424 E→K: Unable to form stable complex with TnrA. In the presence of glutamine, this mutant derepresses amtB-lacZ fusion and glnRA-lacZ fusion. Although it is defective in regulation, this mutant retains enzymatic specific activity and similar affinity for ATP, glutamate and glutamine compared to the wild-type. Slightly less sensitive to inhibition by glutamine.
4lnkA B. Subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of gs-glutamate-amppcp complex (see paper)
28% identity, 85% coverage: 21:443/500 of query aligns to 1:396/443 of 4lnkA
- active site: D52 (= D75), E131 (= E152), E133 (= E154), E188 (= E206), E195 (= E221), H244 (= H270), R315 (= R338), E332 (= E376), R334 (= R378)
- binding adenosine-5'-diphosphate: K43 (≠ A66), M50 (≠ R73), F198 (= F224), Y200 (≠ P226), N246 (≠ H272), S248 (≠ R274), S324 (≠ G347), S328 (≠ K351), R330 (≠ T374)
- binding glutamic acid: E133 (= E154), E188 (= E206), V189 (= V207), N239 (≠ A265), G240 (= G266), G242 (= G268), E303 (= E326)
- binding magnesium ion: E131 (= E152), E188 (= E206), E195 (= E221), H244 (= H270), E332 (= E376)
4lniA B. Subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of the transition state complex (see paper)
28% identity, 85% coverage: 21:443/500 of query aligns to 1:396/443 of 4lniA
- active site: D52 (= D75), E131 (= E152), E133 (= E154), E188 (= E206), E195 (= E221), H244 (= H270), R315 (= R338), E332 (= E376), R334 (= R378)
- binding adenosine-5'-diphosphate: E131 (= E152), E183 (≠ K201), D197 (≠ E223), Y200 (≠ P226), N246 (≠ H272), S248 (≠ R274), R320 (= R343), R330 (≠ T374)
- binding magnesium ion: E131 (= E152), E131 (= E152), E133 (= E154), E188 (= E206), E195 (= E221), E195 (= E221), H244 (= H270), E332 (= E376)
- binding l-methionine-s-sulfoximine phosphate: E133 (= E154), E188 (= E206), H244 (= H270), R297 (= R320), E303 (= E326), R315 (= R338), R334 (= R378)
4s0rD Structure of gs-tnra complex (see paper)
28% identity, 85% coverage: 21:443/500 of query aligns to 5:400/447 of 4s0rD
- active site: D56 (= D75), E135 (= E152), E137 (= E154), E192 (= E206), E199 (= E221), H248 (= H270), R319 (= R338), E336 (= E376), R338 (= R378)
- binding glutamine: E137 (= E154), E192 (= E206), R301 (= R320), E307 (= E326)
- binding magnesium ion: I66 (≠ A85), E135 (= E152), E135 (= E152), E199 (= E221), H248 (= H270), H248 (= H270), E336 (= E376)
- binding : F63 (= F82), V64 (≠ I83), R65 (≠ E84), I66 (≠ A85), D161 (≠ E175), G241 (= G263), V242 (≠ K264), N243 (≠ A265), G305 (≠ H324), Y306 (≠ Q325), Y376 (= Y414)
Sites not aligning to the query:
7tdpA Structure of paenibacillus polymyxa gs bound to met-sox-p-adp (transition state complex) to 1.98 angstom (see paper)
26% identity, 92% coverage: 23:482/500 of query aligns to 2:422/439 of 7tdpA
- binding adenosine-5'-diphosphate: N123 (≠ Q148), G125 (≠ M150), E127 (= E152), E179 (≠ K201), D193 (≠ E223), Y196 (≠ P226), N242 (≠ H272), S244 (≠ R274), R316 (= R343), R326 (≠ T374)
- binding magnesium ion: E127 (= E152), E127 (= E152), E129 (= E154), E184 (= E206), E191 (= E221), E191 (= E221), H240 (= H270), E328 (= E376)
- binding l-methionine-s-sulfoximine phosphate: E127 (= E152), E129 (= E154), E184 (= E206), E191 (= E221), G236 (= G266), H240 (= H270), R293 (= R320), E299 (= E326), R311 (= R338), R330 (= R378)
7tfaB Glutamine synthetase (see paper)
26% identity, 92% coverage: 23:482/500 of query aligns to 2:424/441 of 7tfaB
- binding glutamine: E131 (= E154), Y153 (= Y173), E186 (= E206), G238 (= G266), H242 (= H270), R295 (= R320), E301 (= E326)
- binding magnesium ion: E129 (= E152), E131 (= E154), E186 (= E206), E193 (= E221), H242 (= H270), E330 (= E376)
- binding : Y58 (≠ F82), R60 (≠ E84), V187 (= V207), N237 (≠ A265), G299 (≠ H324), Y300 (≠ Q325), R313 (= R338), M424 (= M482)
2whiA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a purine analogue inhibitor and l-methionine-s- sulfoximine phosphate. (see paper)
27% identity, 91% coverage: 22:474/500 of query aligns to 1:457/476 of 2whiA
- active site: D52 (= D75), E131 (= E152), E133 (= E154), E217 (= E206), E225 (≠ G214), H274 (= H270), R345 (= R338), E364 (= E376), R366 (= R378)
- binding 1-(3,4-dichlorobenzyl)-3,7-dimethyl-8-morpholin-4-yl-3,7-dihydro-1H-purine-2,6-dione: Y127 (≠ M150), G129 (vs. gap), F230 (≠ Q219), H276 (= H272), S278 (≠ R274), W280 (≠ V276), K359 (≠ Q371), R362 (≠ T374)
- binding magnesium ion: E131 (= E152), E131 (= E152), E133 (= E154), E217 (= E206), E225 (≠ G214), E225 (≠ G214), H274 (= H270), E364 (= E376)
- binding l-methionine-s-sulfoximine phosphate: E131 (= E152), E133 (= E154), E217 (= E206), E225 (≠ G214), G270 (= G266), H274 (= H270), R327 (= R320), E333 (= E326), R345 (= R338), R366 (= R378)
- binding phosphate ion: E131 (= E152), R350 (= R343), E364 (= E376)
1htoA Crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis (see paper)
27% identity, 91% coverage: 22:474/500 of query aligns to 2:458/477 of 1htoA
- active site: D53 (= D75), E132 (= E152), E134 (= E154), E218 (= E206), E226 (≠ G214), H275 (= H270), R346 (= R338), E365 (= E376), R367 (= R378)
- binding adenosine monophosphate: Y128 (≠ M150), G130 (vs. gap), E132 (= E152), F231 (≠ Q219), H277 (= H272), S279 (≠ R274), R363 (≠ T374)
- binding manganese (ii) ion: E132 (= E152), H275 (= H270), E365 (= E376)
P9WN39 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 5 papers)
27% identity, 91% coverage: 22:474/500 of query aligns to 3:459/478 of P9WN39
- E133 (= E152) binding
- E135 (= E154) binding
- E219 (= E206) binding
- E227 (≠ G214) binding
- H276 (= H270) binding
- E366 (= E376) binding
- Y406 (≠ H420) modified: O-AMP-tyrosine; mutation to F: Unable to be adenylylated.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
4acfA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with imidazopyridine inhibitor ((4-(6-bromo-3- (butylamino)imidazo(1,2-a)pyridin-2-yl)phenoxy) acetic acid) and l- methionine-s-sulfoximine phosphate.
27% identity, 90% coverage: 24:474/500 of query aligns to 2:456/475 of 4acfA
- active site: D51 (= D75), E130 (= E152), E132 (= E154), E216 (= E206), E224 (≠ G214), H273 (= H270), R344 (= R338), E363 (= E376), R365 (= R378)
- binding {4-[6-bromo-3-(butylamino)imidazo[1,2-a]pyridin-2-yl]phenoxy}acetic acid: Y126 (≠ M150), F229 (≠ Q219), H275 (= H272), Q276 (≠ M273), W279 (≠ V276), N356 (= N359), K358 (≠ Q371), R361 (≠ T374)
- binding magnesium ion: E130 (= E152), E130 (= E152), E132 (= E154), E216 (= E206), E224 (≠ G214), E224 (≠ G214), H273 (= H270), E363 (= E376)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E152), E132 (= E154), E216 (= E206), E224 (≠ G214), G269 (= G266), H273 (= H270), R326 (= R320), E332 (= E326), R344 (= R338), R365 (= R378)
3zxvA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with tri-substituted imidazole inhibitor (4-(2-tert-butyl- 4-(6-methoxynaphthalen-2-yl)-1h-imidazol-5-yl)pyridin-2-amine) and l- methionine-s-sulfoximine phosphate (see paper)
27% identity, 90% coverage: 24:474/500 of query aligns to 2:456/475 of 3zxvA
- active site: D51 (= D75), E130 (= E152), E132 (= E154), E216 (= E206), E224 (≠ G214), H273 (= H270), R344 (= R338), E363 (= E376), R365 (= R378)
- binding magnesium ion: E130 (= E152), E130 (= E152), E132 (= E154), E216 (= E206), E224 (≠ G214), E224 (≠ G214), H273 (= H270), E363 (= E376)
- binding 4-(2-tert-butyl-4-(6-methoxynaphthalen-2-yl)-3h-imidazol-4-yl)pyridin-2-amine: Y126 (≠ M150), G128 (vs. gap), F229 (≠ Q219), H275 (= H272), S277 (≠ R274), K358 (≠ Q371), R361 (≠ T374)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E152), E132 (= E154), E216 (= E206), E224 (≠ G214), G269 (= G266), H273 (= H270), R326 (= R320), E332 (= E326), R344 (= R338), R365 (= R378)
3zxrA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with tri-substituted imidazole inhibitor (3-(2-tert-butyl- 5-(pyridin-4-yl)-1h-imidazol-4-yl)quinoline) and l-methionine-s- sulfoximine phosphate. (see paper)
27% identity, 90% coverage: 24:474/500 of query aligns to 2:456/475 of 3zxrA
- active site: D51 (= D75), E130 (= E152), E132 (= E154), E216 (= E206), E224 (≠ G214), H273 (= H270), R344 (= R338), E363 (= E376), R365 (= R378)
- binding 3-(2-tert-butyl-5-(pyridin-4-yl)-1h-imidazol-4-yl)quinoline: G128 (vs. gap), F229 (≠ Q219), H275 (= H272), S277 (≠ R274), R361 (≠ T374)
- binding magnesium ion: E130 (= E152), E130 (= E152), E132 (= E154), E216 (= E206), E224 (≠ G214), E224 (≠ G214), H273 (= H270), E363 (= E376)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E152), E132 (= E154), E216 (= E206), E224 (≠ G214), H273 (= H270), R326 (= R320), E332 (= E326), R344 (= R338), R365 (= R378)
2bvcA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a transition state mimic (see paper)
27% identity, 90% coverage: 24:474/500 of query aligns to 2:456/475 of 2bvcA
- active site: D51 (= D75), E130 (= E152), E132 (= E154), E216 (= E206), E224 (≠ G214), H273 (= H270), R344 (= R338), E363 (= E376), R365 (= R378)
- binding adenosine-5'-diphosphate: E130 (= E152), E211 (≠ K201), K212 (≠ Y202), N226 (≠ I216), F229 (≠ Q219), H275 (= H272), S277 (≠ R274), R344 (= R338), R349 (= R343), R361 (≠ T374), E363 (= E376)
- binding magnesium ion: E130 (= E152), E130 (= E152), E132 (= E154), E216 (= E206), E224 (≠ G214), E224 (≠ G214), H273 (= H270), E363 (= E376)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E152), E132 (= E154), E216 (= E206), E224 (≠ G214), G269 (= G266), H273 (= H270), R326 (= R320), E332 (= E326), R344 (= R338), R365 (= R378)
7tf6A Glutamine synthetase (see paper)
26% identity, 86% coverage: 23:451/500 of query aligns to 2:399/438 of 7tf6A
- binding glutamine: E128 (= E154), E183 (= E206), G235 (= G266), H239 (= H270), R292 (= R320), E298 (= E326)
- binding magnesium ion: E126 (= E152), E128 (= E154), E183 (= E206), E190 (= E221), H239 (= H270), E327 (= E376)
- binding : F58 (= F82), R60 (≠ E84), G232 (= G263), N234 (≠ A265), G296 (≠ H324), Y297 (≠ Q325), R310 (= R338), Y367 (≠ H420)
Sites not aligning to the query:
7tdvC Glutamine synthetase (see paper)
26% identity, 86% coverage: 23:451/500 of query aligns to 3:404/443 of 7tdvC
- binding adenosine-5'-diphosphate: G129 (≠ M150), E131 (= E152), E183 (≠ K201), D197 (≠ E223), F198 (= F224), K199 (≠ L225), Y200 (≠ P226), N246 (≠ H272), V247 (≠ M273), S248 (≠ R274), R320 (= R343), S328 (≠ K351), R330 (≠ T374)
- binding magnesium ion: E131 (= E152), E131 (= E152), E133 (= E154), E188 (= E206), E195 (= E221), E195 (= E221), H244 (= H270), E332 (= E376)
- binding l-methionine-s-sulfoximine phosphate: E131 (= E152), E133 (= E154), E188 (= E206), E195 (= E221), G240 (= G266), H244 (= H270), R297 (= R320), E303 (= E326), R315 (= R338)
7tf9S L. Monocytogenes gs(14)-q-glnr peptide (see paper)
28% identity, 86% coverage: 21:451/500 of query aligns to 1:404/443 of 7tf9S
- binding glutamine: E133 (= E154), Y155 (= Y173), E188 (= E206), G240 (= G266), G242 (= G268), R297 (= R320), E303 (= E326)
- binding magnesium ion: E131 (= E152), E133 (= E154), E188 (= E206), E195 (= E221), H244 (= H270), E332 (= E376)
- binding : F59 (= F82), V60 (≠ I83)
Sites not aligning to the query:
7tenA Glutamine synthetase (see paper)
27% identity, 86% coverage: 22:451/500 of query aligns to 1:403/442 of 7tenA
- binding adenosine-5'-diphosphate: G128 (≠ M150), E130 (= E152), E182 (≠ K201), D196 (≠ E223), F197 (= F224), K198 (≠ L225), Y199 (≠ P226), N245 (≠ H272), S247 (≠ R274), R319 (= R343), S327 (≠ K351), R329 (≠ D353)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E152), E132 (= E154), E187 (= E206), E194 (= E221), N238 (≠ A265), G239 (= G266), H243 (= H270), R296 (= R320), E302 (= E326), R314 (= R338), R333 (= R378)
Query Sequence
>350313 FitnessBrowser__Btheta:350313
MNQELLMNPNCLVAALEKPAAEFTKADIISFIQKNNIRMVNFMYPAADGRLKTLNFVINN
AAYLDAILTCGERVDGSSLFPFIEAGSSDLYVVPRFRTAFVDPFAEIPTLSMLCSFFNKD
GEPLESSPEHTLHKACKAFTDVTGMEFQAMGELEYYVISPDTGMFQATDQRGYHESAPYA
KFNDFRTQCMSYIAQTGGQIKYGHSEVGNFTLDGMIYEQNEIEFLPVHAEDAADQLMIAK
WVIRNLGYRYGYNVTFAPKITAGKAGSGLHVHMRIVKDGQNQMLKDGVLSETARKAIAGM
MELAPSITAFGNTNPTSYFRLVPHQEAPTNVCWGDRNRSVLVRVPLGWAAKTDMCTLANP
LESESHFDTSQKQTVEMRSPDGSADLYQLLAGLAVACRHGFEIEQALDIAKRTYVNVNIH
QKENEDKLKALAQLPDSCAASAECLQKQRAVFEQYNVFSPAMIDGIIRKLRSYEDKTLRA
DMEGKPEEMLELVHKYFHCG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory