Comparing 350320 FitnessBrowser__Btheta:350320 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
28% identity, 96% coverage: 4:480/497 of query aligns to 3:463/484 of P09099
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
27% identity, 96% coverage: 4:480/497 of query aligns to 3:455/476 of 2itmA
3i8bA The crystal structure of xylulose kinase from bifidobacterium adolescentis
24% identity, 97% coverage: 2:482/497 of query aligns to 5:504/506 of 3i8bA
P18157 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Bacillus subtilis (strain 168) (see paper)
25% identity, 98% coverage: 2:487/497 of query aligns to 4:486/496 of P18157
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
23% identity, 78% coverage: 2:389/497 of query aligns to 3:377/490 of 3ll3B
Sites not aligning to the query:
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
24% identity, 99% coverage: 3:492/497 of query aligns to 1:476/485 of 6k76A
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
22% identity, 78% coverage: 2:389/497 of query aligns to 4:379/492 of 3ll3A
Sites not aligning to the query:
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
23% identity, 98% coverage: 2:487/497 of query aligns to 6:487/501 of O34154
Sites not aligning to the query:
5ya2A Crystal structure of lsrk-hpr complex with adp (see paper)
24% identity, 69% coverage: 139:482/497 of query aligns to 132:475/478 of 5ya2A
5ya1A Crystal structure of lsrk-hpr complex with atp (see paper)
24% identity, 69% coverage: 139:482/497 of query aligns to 132:475/478 of 5ya1A
3kzbA Crystal structure of xylulokinase from chromobacterium violaceum
24% identity, 54% coverage: 1:266/497 of query aligns to 4:266/498 of 3kzbA
Sites not aligning to the query:
O86033 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
25% identity, 53% coverage: 2:264/497 of query aligns to 4:265/497 of O86033
2w41B Crystal structure of plasmodium falciparum glycerol kinase with adp (see paper)
24% identity, 89% coverage: 27:469/497 of query aligns to 20:479/507 of 2w41B
2w40A Crystal structure of plasmodium falciparum glycerol kinase with bound glycerol (see paper)
24% identity, 89% coverage: 27:469/497 of query aligns to 14:473/501 of 2w40A
3ge1A 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
23% identity, 98% coverage: 2:487/497 of query aligns to 5:487/499 of 3ge1A
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
23% identity, 98% coverage: 2:487/497 of query aligns to 4:486/498 of Q5HGD2
6udeB Crystal structure of glycerol kinase from elizabethkingia anophelis nuhp1 in complex with adp and glycerol
24% identity, 56% coverage: 2:277/497 of query aligns to 4:296/495 of 6udeB
Sites not aligning to the query:
3h3nX Glycerol kinase h232r with glycerol (see paper)
23% identity, 98% coverage: 2:487/497 of query aligns to 5:487/501 of 3h3nX
O34153 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus casseliflavus (Enterococcus flavescens) (see 3 papers)
23% identity, 98% coverage: 2:487/497 of query aligns to 6:488/506 of O34153
Q9NJP9 Glycerol kinase, glycosomal; GK; Glycerokinase; ATP:glycerol 3-phosphotransferase; EC 2.7.1.30 from Trypanosoma brucei brucei (see 2 papers)
24% identity, 77% coverage: 7:389/497 of query aligns to 8:399/512 of Q9NJP9
Sites not aligning to the query:
>350320 FitnessBrowser__Btheta:350320
MFLLGYDIGSSSVKASLVNAETGKCVSSAFFPKTEAKIIAVNPGWAEQDPESWWENLKLS
TQAIMAESGVSAAEIKAIGISYQMHGLVCVDKNQQVLRPAIIWCDSRAVPFGQQAFETIG
EERCLSHLLNSPGNFTASKLAWIKQNEPAVYEQIYKIMLPGDYIAMKLSGDICTTVSGLS
EGMFWDFKNNRVADFLMDYYGFDSSLIADIKPTFAEQGRVNAVAANELGLKEGTPITYRA
GDQPNNALSLNVFNPGEIASTAGTSGVVYGVNGEVNYDPQSRVNTFAHVNHTMEQTRLGV
LLCINGTGILNSWVKRNIAPEGISYNEMNVLASKAPIGSAGISILPFGNGAERMLNNKEI
GCSIRGVDFNAHGKHHIIRAAQEGIVFSFKYGIDIMEQMGIPVKKIHAGHANMFLSSIFR
DTLAGVTGATIELYDTDGSVGAAKGAGIGAGIYKDNNEAFATLDKLDVIEPNIAKRQEYA
DAYARWKYNINNDIITF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory