Comparing 350332 FitnessBrowser__Btheta:350332 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
29% identity, 56% coverage: 225:512/512 of query aligns to 2:275/276 of Q9NQR4
4hg5A Structural insights into yeast nit2: wild-type yeast nit2 in complex with oxaloacetate (see paper)
23% identity, 53% coverage: 235:506/512 of query aligns to 9:303/304 of 4hg5A
4hg3A Structural insights into yeast nit2: wild-type yeast nit2 in complex with alpha-ketoglutarate (see paper)
23% identity, 53% coverage: 235:506/512 of query aligns to 9:303/304 of 4hg3A
P47016 Deaminated glutathione amidase; dGSH amidase; Nitrilase homolog 1; EC 3.5.1.128 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
23% identity, 53% coverage: 235:506/512 of query aligns to 12:306/307 of P47016
4hgdA Structural insights into yeast nit2: c169s mutant of yeast nit2 in complex with an endogenous peptide-like ligand (see paper)
23% identity, 53% coverage: 235:506/512 of query aligns to 8:299/299 of 4hgdA
Q94JV5 Deaminated glutathione amidase, chloroplastic/cytosolic; dGSH amidase; Nitrilase-like protein 2; Protein nitrilase 1 homolog; AtNit1; Protein Nit1 homolog; EC 3.5.1.128 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
24% identity, 54% coverage: 214:491/512 of query aligns to 24:294/307 of Q94JV5
Sites not aligning to the query:
5h8jB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine (see paper)
31% identity, 36% coverage: 327:508/512 of query aligns to 99:286/297 of 5h8jB
Sites not aligning to the query:
5h8iC Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine (see paper)
31% identity, 36% coverage: 327:508/512 of query aligns to 103:290/301 of 5h8iC
Sites not aligning to the query:
7uciA Sxta methyltransferase and decarboxylase didomain in complex with mn2+ and sah (see paper)
24% identity, 33% coverage: 41:209/512 of query aligns to 520:683/686 of 7uciA
Sites not aligning to the query:
5h8lB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine (see paper)
30% identity, 36% coverage: 327:508/512 of query aligns to 100:287/298 of 5h8lB
Sites not aligning to the query:
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
24% identity, 55% coverage: 227:506/512 of query aligns to 9:267/269 of 6ypaB
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
24% identity, 55% coverage: 227:506/512 of query aligns to 3:261/263 of 7ovgA
2refA Crystal structure of the loading gnatl domain of cura from lyngbya majuscula soaked with malonyl-coa (see paper)
25% identity, 39% coverage: 9:209/512 of query aligns to 5:199/203 of 2refA
P46011 Bifunctional nitrilase/nitrile hydratase NIT4; Cyanoalanine nitrilase; Nitrilase 4; EC 3.5.5.1; EC 3.5.5.4; EC 4.2.1.65 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 41% coverage: 222:431/512 of query aligns to 31:246/355 of P46011
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
23% identity, 55% coverage: 227:506/512 of query aligns to 1:259/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
23% identity, 55% coverage: 227:506/512 of query aligns to 1:259/261 of 3klcA
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
23% identity, 55% coverage: 227:506/512 of query aligns to 2:260/262 of Q9UYV8
>350332 FitnessBrowser__Btheta:350332
MEQHPIKINKVQIRNLQIEDYAQLSQSFTRVYSDGSDVFWTHAQIKKLISIFPEGQIVTV
VDDKIVGCALSIILDYDKVKNDHTYAQVTGKETFNTHNPEGNILYGIEVFIHPGYRGLRL
ARRMYEYRKELCETLNLKAIMFGGRIPNYHKYADKMRPKEYIARVRQREIYDPVLTFQLS
NDFHVRKVMTNYLPNDEESKHYACLLQWDNIYYQPPTQEYINPKTTVRVGLVQWQMRSYK
TLDDLFEQVEFFVDAVSDYKSDFVLFPEYFNAPLMSKFNDKGESQAIRGLAKYTDEIRDR
FINLAISYNINIITGSMPYVKEDGLLYNVGFLCRRDGTYEMYEKMHVTPDEIKSWGLSGG
KLLQTFDTDCAKVGVLICYDVEFPELSRLMADQGMQILFVPFLTDTQNAYSRVRVCAQAR
AIENECFVVIAGCVGNLPRVHNMDIQYAQSGVFTPCDFAFPTDGKRAEATPNTEMILVSD
VDLDLLNALHTYGSVRNLKDRRNDVYEVRFKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory