Comparing 350398 FitnessBrowser__Btheta:350398 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8iytA Crystal structure of serine palmitoyltransferase complexed with d- methylserine
57% identity, 98% coverage: 2:389/394 of query aligns to 3:390/394 of 8iytA
8h29A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-threonine (see paper)
57% identity, 98% coverage: 2:389/394 of query aligns to 3:390/394 of 8h29A
8h21A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-alanine (see paper)
57% identity, 98% coverage: 2:389/394 of query aligns to 3:390/394 of 8h21A
8h20A Serine palmitoyltransferase from sphingobacterium multivorum complexed with glycine (see paper)
57% identity, 98% coverage: 2:389/394 of query aligns to 3:390/394 of 8h20A
8h1yA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-homoserine (see paper)
57% identity, 98% coverage: 2:389/394 of query aligns to 3:390/394 of 8h1yA
8h1qA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-serine (see paper)
57% identity, 98% coverage: 2:389/394 of query aligns to 3:390/394 of 8h1qA
8guhA Serine palmitoyltransferase from sphingobacterium multivorum complexed with tris (see paper)
57% identity, 98% coverage: 2:389/394 of query aligns to 3:390/394 of 8guhA
3a2bA Crystal structure of serine palmitoyltransferase from sphingobacterium multivorum with substrate l-serine (see paper)
57% identity, 98% coverage: 2:389/394 of query aligns to 3:390/392 of 3a2bA
Q5W264 4-hydroxy-2,2'-bipyrrole-5-methanol synthase PigH; HBM synthase; Aminotransferase PigH; EC 2.3.2.- from Serratia sp. (strain ATCC 39006) (see paper)
37% identity, 89% coverage: 38:387/394 of query aligns to 279:630/653 of Q5W264
Sites not aligning to the query:
7v58B Structural insights into the substrate selectivity of acyl-coa transferase (see paper)
34% identity, 95% coverage: 19:394/394 of query aligns to 20:399/400 of 7v58B
2xbnA Inhibition of the plp-dependent enzyme serine palmitoyltransferase by cycloserine: evidence for a novel decarboxylative mechanism of inactivation (see paper)
35% identity, 100% coverage: 2:394/394 of query aligns to 9:398/398 of 2xbnA
2w8jA Spt with plp-ser (see paper)
35% identity, 100% coverage: 2:394/394 of query aligns to 9:398/398 of 2w8jA
Q93UV0 Serine palmitoyltransferase; SPT; EC 2.3.1.50 from Sphingomonas paucimobilis (Pseudomonas paucimobilis) (see 4 papers)
35% identity, 100% coverage: 2:394/394 of query aligns to 30:419/420 of Q93UV0
Sites not aligning to the query:
7poaA An irreversible, promiscuous and highly thermostable claisen- condensation biocatalyst drives the synthesis of substituted pyrroles (see paper)
36% identity, 96% coverage: 15:394/394 of query aligns to 17:397/398 of 7poaA
4bmkA Serine palmitoyltransferase k265a from s. Paucimobilis with bound plp- myriocin aldimine (see paper)
34% identity, 100% coverage: 2:394/394 of query aligns to 9:398/398 of 4bmkA
2x8uA Sphingomonas wittichii serine palmitoyltransferase (see paper)
36% identity, 91% coverage: 35:394/394 of query aligns to 37:398/399 of 2x8uA
3tqxA Structure of the 2-amino-3-ketobutyrate coenzyme a ligase (kbl) from coxiella burnetii (see paper)
35% identity, 94% coverage: 21:391/394 of query aligns to 19:393/396 of 3tqxA
7u7hA Cysteate acyl-acp transferase from alistipes finegoldii (see paper)
35% identity, 94% coverage: 23:391/394 of query aligns to 26:398/423 of 7u7hA
P0AB77 2-amino-3-ketobutyrate coenzyme A ligase; AKB ligase; Glycine acetyltransferase; EC 2.3.1.29 from Escherichia coli (strain K12) (see paper)
35% identity, 95% coverage: 19:394/394 of query aligns to 18:397/398 of P0AB77
1fc4A 2-amino-3-ketobutyrate coa ligase (see paper)
35% identity, 95% coverage: 19:394/394 of query aligns to 21:400/401 of 1fc4A
>350398 FitnessBrowser__Btheta:350398
MGLLQEKLAKYDLPQKFMAQGVYPYFREIEGKQGTEVEMGGQHVLMFGSNAYTGLTGDER
VIEAGIKAMRKYGSGCAGSRFLNGTLDLHVQLEKELAAFVGKDEALCFSTGFTVNSGVIS
CLTDRNDYIICDDRDHASIVDGRRLSFSQQLKYKHNDMADLEKQLQKCNPDSVKLIIVDG
VFSMEGDLANLPEIVRLKHKYNATIMVDEAHGLGVFGKQGRGVCDHFGLTHEVDLIMGTF
SKSLASIGGFIAADSSIINWLRHNARTYIFSASNTPAATAAALEALHIIQNEPERLNALW
EATNYALRRFREAGFEIGATESPIIPLYVRDTEKTFMVTKLAFDEGVFINPVIPPACAPQ
DTLVRVALMATHTKEQIDSAVEKLVKAFKALDLL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory