SitesBLAST
Comparing 350543 BT1015 putative oxidoreductase (NCBI ptt file) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3gegA Fingerprint and structural analysis of a scor enzyme with its bound cofactor from clostridium thermocellum (see paper)
41% identity, 81% coverage: 54:293/295 of query aligns to 2:230/241 of 3gegA
- active site: S132 (= S188), Y145 (= Y201), K149 (= K205)
- binding nicotinamide-adenine-dinucleotide: G8 (= G60), H11 (≠ E63), I13 (= I65), D32 (= D84), I33 (= I85), R37 (≠ S89), D54 (= D105), V55 (= V106), N81 (= N132), C83 (≠ G134), R84 (≠ I135), I130 (= I186), A131 (≠ C187), S132 (= S188), Y145 (= Y201), K149 (= K205), P174 (= P231), G175 (= G232), I177 (= I234), V179 (≠ T236)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
34% identity, 79% coverage: 54:287/295 of query aligns to 8:242/244 of 4nbuB
- active site: G18 (= G64), N111 (= N156), S139 (= S188), Q149 (≠ S198), Y152 (= Y201), K156 (= K205)
- binding acetoacetyl-coenzyme a: D93 (≠ F138), K98 (≠ E143), S139 (= S188), N146 (≠ E195), V147 (≠ P196), Q149 (≠ S198), Y152 (= Y201), F184 (≠ W233), M189 (≠ N238), K200 (vs. gap)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G60), N17 (≠ E63), G18 (= G64), I19 (= I65), D38 (= D84), F39 (≠ I85), V59 (= V104), D60 (= D105), V61 (= V106), N87 (= N132), A88 (≠ V133), G89 (= G134), I90 (= I135), T137 (≠ I186), S139 (= S188), Y152 (= Y201), K156 (= K205), P182 (= P231), F184 (≠ W233), T185 (≠ I234), T187 (= T236), M189 (≠ N238)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
35% identity, 80% coverage: 54:288/295 of query aligns to 6:237/240 of 2d1yA
- active site: G16 (= G64), S135 (= S188), N145 (≠ S198), Y148 (= Y201), K152 (= K205)
- binding nicotinamide-adenine-dinucleotide: G12 (= G60), R15 (≠ E63), I17 (= I65), D36 (= D84), L37 (≠ I85), R38 (≠ N86), V55 (= V104), D56 (= D105), L57 (≠ V106), N83 (= N132), A84 (≠ V133), A85 (≠ G134), I86 (= I135), V133 (≠ I186), S135 (= S188), Y148 (= Y201), K152 (= K205), P178 (= P231), G179 (= G232), I181 (= I234), T183 (= T236), A185 (≠ N238), V186 (≠ Y239)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
33% identity, 80% coverage: 54:290/295 of query aligns to 8:255/255 of 5itvA
- active site: G18 (= G64), S141 (= S188), Y154 (= Y201), K158 (= K205)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G60), S17 (≠ E63), G18 (= G64), I19 (= I65), D38 (= D84), I39 (= I85), T61 (≠ V104), I63 (≠ V106), N89 (= N132), G91 (= G134), T139 (≠ I186), S141 (= S188), Y154 (= Y201), K158 (= K205), P184 (= P231), G185 (= G232), I186 (≠ W233), I187 (= I234)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
33% identity, 78% coverage: 57:286/295 of query aligns to 9:242/248 of Q9KJF1
- S15 (≠ E63) binding
- D36 (= D84) binding
- D62 (= D105) binding
- I63 (≠ V106) binding
- N89 (= N132) binding
- Y153 (= Y201) binding
- K157 (= K205) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
33% identity, 78% coverage: 57:286/295 of query aligns to 8:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G60), M16 (≠ I65), D35 (= D84), I36 (= I85), I62 (≠ V106), N88 (= N132), G90 (= G134), I138 (= I186), S140 (= S188), Y152 (= Y201), K156 (= K205), I185 (= I234)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
34% identity, 79% coverage: 54:287/295 of query aligns to 6:237/239 of 4nbtA
- active site: G16 (= G64), S132 (= S188), Y145 (= Y201), K149 (= K205)
- binding nicotinamide-adenine-dinucleotide: G12 (= G60), K15 (≠ E63), G16 (= G64), L17 (≠ I65), D36 (= D84), L37 (≠ I85), L52 (≠ V104), N53 (≠ D105), V54 (= V106), N80 (= N132), A81 (≠ V133), G82 (= G134), I130 (= I186), S132 (= S188), Y145 (= Y201), K149 (= K205), P177 (= P231), G178 (= G232), I180 (= I234), T182 (= T236)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
33% identity, 79% coverage: 54:287/295 of query aligns to 9:240/243 of 4i08A
- active site: G19 (= G64), N113 (= N156), S141 (= S188), Q151 (≠ S198), Y154 (= Y201), K158 (= K205)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G60), S17 (≠ A62), R18 (≠ E63), I20 (= I65), T40 (≠ N86), N62 (≠ D105), V63 (= V106), N89 (= N132), A90 (≠ V133), G140 (≠ C187), S141 (= S188), Y154 (= Y201), K158 (= K205), P184 (= P231), G185 (= G232), T189 (= T236)
7xqmB Indel-mutant short chain dehydrogenase bound to sah (see paper)
33% identity, 82% coverage: 54:294/295 of query aligns to 7:249/253 of 7xqmB
- binding s-adenosyl-l-homocysteine: G13 (= G60), I16 (= I65), D34 (= D84), L35 (≠ I85), R36 (≠ N86), V53 (= V104), L55 (≠ V106), N81 (= N132), A82 (≠ V133), A83 (≠ G134), Y146 (= Y201)
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
34% identity, 80% coverage: 54:290/295 of query aligns to 8:227/227 of 5itvD
- active site: G18 (= G64), S141 (= S188), Y154 (= Y201), K158 (= K205)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G60), S17 (≠ E63), G18 (= G64), I19 (= I65), D38 (= D84), I39 (= I85), T61 (≠ V104), D62 (= D105), I63 (≠ V106), N89 (= N132), T139 (≠ I186), S141 (= S188), Y154 (= Y201), K158 (= K205), P184 (= P231), G185 (= G232), I187 (= I234)
5vt6A Crystal structure of acetoacetyl-coa reductase from burkholderia pseudomallei 1710b complexed with NADP
32% identity, 80% coverage: 53:287/295 of query aligns to 1:242/245 of 5vt6A
- active site: G12 (= G64), D102 (= D148), S138 (= S188), Y151 (= Y201), K155 (= K205)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G60), G11 (≠ E63), G12 (= G64), L13 (≠ I65), H32 (vs. gap), S33 (vs. gap), N36 (≠ D84), V58 (= V104), D59 (= D105), V60 (= V106), N86 (= N132), A87 (≠ V133), G88 (= G134), I89 (= I135), I136 (= I186), Y151 (= Y201), K155 (= K205), P181 (= P231), Y183 (≠ W233), L184 (≠ I234), T186 (= T236)
3o03A Quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 (see paper)
35% identity, 80% coverage: 51:287/295 of query aligns to 8:246/254 of 3o03A
- active site: G22 (= G64), S147 (= S188), V157 (vs. gap), Y160 (= Y201), K164 (= K205)
- binding calcium ion: S147 (= S188), M148 (≠ L192), P190 (= P231)
- binding D-gluconic acid: I99 (≠ S136), R101 (≠ F138), S147 (= S188), M149 (= M193), R154 (≠ S198), Y160 (= Y201)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G60), Y21 (≠ E63), G22 (= G64), I23 (= I65), D42 (= D84), I43 (= I85), L47 (vs. gap), D68 (= D105), V69 (= V106), N95 (= N132), A96 (≠ V133), G97 (= G134), I145 (= I186), Y160 (= Y201), K164 (= K205), P190 (= P231)
4nbwA Crystal structure of fabg from plesiocystis pacifica (see paper)
36% identity, 80% coverage: 53:288/295 of query aligns to 1:250/253 of 4nbwA
- active site: G12 (= G64), S146 (= S188), Y159 (= Y201), K163 (= K205)
- binding nicotinamide-adenine-dinucleotide: G8 (= G60), N11 (≠ E63), G12 (= G64), I13 (= I65), D32 (= D84), L33 (≠ I85), V57 (= V104), D58 (= D105), V59 (= V106), N85 (= N132), A86 (≠ V133), G87 (= G134), S146 (= S188), Y159 (= Y201), K163 (= K205), I192 (= I234), T194 (= T236)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
32% identity, 79% coverage: 54:287/295 of query aligns to 9:244/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G60), S17 (≠ A62), R18 (≠ E63), I20 (= I65), T40 (≠ N86), N62 (≠ D105), V63 (= V106), N89 (= N132), A90 (≠ V133), I92 (= I135), V139 (≠ I186), S141 (= S188), Y154 (= Y201), K158 (= K205), P184 (= P231), G185 (= G232), I187 (= I234), T189 (= T236), M191 (≠ N238)
4k6fB X-ray crystal structure of a putative acetoacetyl-coa reductase from burkholderia cenocepacia bound to the co-factor NADP
32% identity, 79% coverage: 54:286/295 of query aligns to 1:241/245 of 4k6fB
- active site: G12 (= G64), N102 (≠ D148), S138 (= S188), Y151 (= Y201), K155 (= K205)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G60), Y32 (≠ V88), S33 (= S89), N36 (≠ Q92), V58 (= V104), D59 (= D105), V60 (= V106), A87 (≠ V133), G88 (= G134), I89 (= I135)
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
33% identity, 80% coverage: 53:287/295 of query aligns to 5:241/244 of 6t62A
- active site: G16 (= G64), S138 (= S188), Y151 (= Y201)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G60), S14 (≠ A62), R15 (≠ E63), A36 (≠ I85), T37 (≠ N86), L58 (≠ V104), D59 (= D105), V60 (= V106), N86 (= N132), A87 (≠ V133), G88 (= G134), I89 (= I135), I136 (= I186), S137 (≠ C187), S138 (= S188), Y151 (= Y201), K155 (= K205), P181 (= P231), G182 (= G232), I184 (= I234), M188 (≠ N238)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
33% identity, 80% coverage: 53:287/295 of query aligns to 5:241/244 of 6wprA
- active site: G16 (= G64), S138 (= S188), Y151 (= Y201)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G60), S14 (≠ A62), R15 (≠ E63), T37 (≠ I85), L58 (≠ V104), D59 (= D105), V60 (= V106), N86 (= N132), A87 (≠ V133), G88 (= G134), I89 (= I135), I136 (= I186), Y151 (= Y201), K155 (= K205), P181 (= P231)
Q6WVP7 NADP-dependent (R)-specific alcohol dehydrogenase; (R)-specific ADH; Ketoreductase; KRED; EC 1.1.1.- from Lentilactobacillus kefiri (Lactobacillus kefiri) (see paper)
32% identity, 82% coverage: 49:290/295 of query aligns to 2:252/252 of Q6WVP7
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
32% identity, 80% coverage: 52:287/295 of query aligns to 3:248/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G60), Q15 (≠ E63), G16 (= G64), I17 (= I65), D36 (= D84), V63 (= V106), N89 (= N132), A91 (≠ G134), S94 (vs. gap), I142 (= I186), S143 (≠ C187), S144 (= S188), Y157 (= Y201), K161 (= K205), P187 (= P231), H188 (≠ G232), I190 (= I234), I194 (≠ N238)
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
33% identity, 79% coverage: 54:287/295 of query aligns to 5:240/243 of 7emgB
Query Sequence
>350543 BT1015 putative oxidoreductase (NCBI ptt file)
MADNYIERQQEQYEARKAAWKQAQKYGKKKTTTSSQVKTEVAGEIVSKSDSLKKRIFVTG
GAEGIGRAIVEAFCKDGHQVAFCDINAVSGQQTARDTGAIFHPVDVSDKEALESCMQQIL
DEWKDIDIVINNVGISKFSSITETSVEDFDKILSVNLRPVFITSRLLAIHRKAQSDSNPY
GRIINICSTRYLMSEPGSEGYAASKGGIYSLTHALALSLSEWNITVNSIAPGWIQTQNYD
QLRPEDHSQHPSRRVGKPEDIARMCLFLCRDENDFINGENITIDGGMTKKMIYTE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory