SitesBLAST
Comparing 350587 FitnessBrowser__Btheta:350587 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8NBZ7 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UGD; UXS-1; hUXS; hUXS1; EC 4.1.1.35 from Homo sapiens (Human) (see 4 papers)
55% identity, 99% coverage: 2:307/309 of query aligns to 89:392/420 of Q8NBZ7
- G98 (= G11) binding
- F99 (= F12) binding
- V100 (≠ I13) binding
- D119 (= D32) binding
- N120 (= N33) binding
- F122 (= F35) binding
- T123 (= T36) binding
- G124 (= G37) binding
- D144 (= D57) binding
- V145 (= V58) binding
- L149 (≠ Y62) binding
- Y150 (≠ S63) binding
- L159 (= L72) binding
- S161 (≠ C74) binding
- K177 (= K90) binding
- T178 (= T91) binding
- N185 (= N98) binding
- G188 (= G101) binding
- K191 (≠ M104) binding
- R192 (= R105) binding
- A200 (= A113) binding
- E204 (= E117) mutation to A: Reduced UDP-glucuronic acid decarboxylase activity.
- Y231 (= Y144) active site, Proton acceptor; binding ; mutation to F: Abolished UDP-glucuronic acid decarboxylase activity.
- K235 (= K148) binding
- R236 (= R149) mutation to H: Strongly reduced UDP-glucuronic acid decarboxylase activity, caused by a local unfolding of the active site that allows for a rotation of the dimer interface, leading to the formation of a homohexamer.
- Y245 (= Y158) binding
- Q248 (= Q161) binding
- E249 (≠ N162) binding
- T261 (= T174) binding
- H267 (≠ L180) binding
- R272 (= R185) binding
- R361 (= R276) mutation to Q: Strongly reduced UDP-glucuronic acid decarboxylase activity.
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
2b69A Crystal structure of human udp-glucoronic acid decarboxylase
55% identity, 99% coverage: 2:307/309 of query aligns to 2:305/312 of 2b69A
- active site: T115 (= T115), S116 (= S116), E117 (= E117), Y144 (= Y144), K148 (= K148), R185 (= R185)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (= F12), V13 (≠ I13), D32 (= D32), N33 (= N33), T36 (= T36), G37 (= G37), D57 (= D57), V58 (= V58), L72 (= L72), A73 (= A73), S74 (≠ C74), A76 (= A76), T91 (= T91), T115 (= T115), Y144 (= Y144), K148 (= K148), I171 (= I171), N173 (= N173), R185 (= R185)
- binding uridine-5'-diphosphate: P61 (= P61), L62 (≠ Y62), Y63 (≠ S63), P78 (= P78), N98 (= N98), G101 (= G101), L102 (= L102), K104 (≠ M104), R105 (= R105), Y158 (= Y158), N173 (= N173), R185 (= R185), V186 (= V186), N189 (= N189), T201 (= T201), Y203 (= Y203), Q208 (= Q208), R210 (= R210), I244 (≠ V246), D270 (= D272)
Q6GMI9 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UXS-1; EC 4.1.1.35 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
54% identity, 99% coverage: 2:306/309 of query aligns to 87:389/418 of Q6GMI9
- R234 (= R149) mutation to H: In Man o' war (mow) mutant; characterized by severe craniofacial defects. Fishes show defective organization and morphogenesis of chondrocytes, perichondrium and bone.
4lk3B Crystal structure of human udp-xylose synthase r236a substitution (see paper)
47% identity, 99% coverage: 2:307/309 of query aligns to 2:267/274 of 4lk3B
- active site: T112 (= T115), S113 (= S116), E114 (= E117), K119 (= K148), R156 (= R185)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (= F12), V13 (≠ I13), D32 (= D32), N33 (= N33), T36 (= T36), G37 (= G37), D57 (= D57), V58 (= V58), L72 (= L72), A73 (= A73), S74 (≠ C74), P75 (= P75), T88 (= T91), A110 (= A113), T112 (= T115), K119 (= K148), I142 (= I171), H151 (≠ L180)
- binding uridine-5'-diphosphate: R156 (= R185), V157 (= V186), N160 (= N189), T172 (= T201), Y174 (= Y203), Q179 (= Q208), R181 (= R210), I215 (≠ V246)
- binding uridine-5'-diphosphate-glucuronic acid: P61 (= P61), L62 (≠ Y62), Y63 (≠ S63), I83 (= I86), K87 (= K90), N95 (= N98), G98 (= G101), L99 (= L102), K101 (≠ M104), Y129 (= Y158), E133 (≠ N162)
4lk3C Crystal structure of human udp-xylose synthase r236a substitution (see paper)
47% identity, 99% coverage: 2:307/309 of query aligns to 2:264/271 of 4lk3C
- active site: T110 (= T115), S111 (= S116), E112 (= E117), K117 (= K148), R154 (= R185)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (= F12), V13 (≠ I13), D32 (= D32), N33 (= N33), T36 (= T36), G37 (= G37), D57 (= D57), V58 (= V58), L72 (= L72), A73 (= A73), S74 (≠ C74), P75 (= P75), T86 (= T91), K117 (= K148), I140 (= I171), H149 (≠ L180)
- binding pyrophosphate 2-: R154 (= R185), V155 (= V186)
- binding uridine-5'-diphosphate-glucuronic acid: P61 (= P61), L62 (≠ Y62), Y63 (≠ S63), N93 (= N98), G96 (= G101), L97 (= L102), K99 (≠ M104), R100 (= R105), Y127 (= Y158), E131 (≠ N162)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
31% identity, 99% coverage: 4:308/309 of query aligns to 3:306/309 of 4zrnA
- active site: T117 (≠ S114), G119 (≠ S116), A120 (≠ E117), Y143 (= Y144), K147 (= K148), Y181 (vs. gap), G185 (≠ R185)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (= I13), D31 (= D32), N32 (= N33), S34 (≠ F35), S35 (≠ T36), G36 (= G37), S51 (= S63), I52 (≠ A64), L73 (= L72), A74 (= A73), A75 (≠ C74), T92 (= T91), S115 (≠ Q112), S116 (≠ A113), Y143 (= Y144), K147 (= K148), Y170 (≠ I171), V173 (≠ T174)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S114), G119 (≠ S116), A120 (≠ E117), Y143 (= Y144), N172 (= N173), G185 (≠ R185), V186 (= V186), H201 (≠ T201), F203 (≠ Y203), Y208 (≠ Q208), R210 (= R210), V244 (= V246), R267 (≠ P269), D270 (= D272)
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
33% identity, 99% coverage: 3:309/309 of query aligns to 2:313/314 of 6zldA
- active site: T126 (= T115), S127 (= S116), S128 (≠ E117), Y149 (= Y144), K153 (= K148)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (= I13), D32 (= D32), H33 (≠ N33), F34 (= F34), I35 (≠ F35), K43 (≠ S38), D62 (= D57), I63 (≠ V58), L81 (= L72), A82 (= A73), A83 (≠ C74), I124 (≠ A113), T126 (= T115), K153 (= K148), Y176 (≠ I171), T178 (≠ N173), R185 (≠ L180), M188 (≠ R185)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (= P75), R88 (≠ P78), T126 (= T115), S127 (= S116), S128 (≠ E117), Y149 (= Y144), F177 (= F172), T178 (≠ N173), R185 (≠ L180), M188 (≠ R185), A189 (≠ V186), R192 (≠ N189), T204 (= T201), F206 (≠ Y203), Q211 (= Q208), R213 (= R210), I250 (≠ V246), E276 (≠ D272)
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
33% identity, 99% coverage: 3:309/309 of query aligns to 2:313/314 of 6zl6A
- active site: T126 (= T115), S127 (= S116), S128 (≠ E117), Y149 (= Y144), K153 (= K148)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (= I13), D32 (= D32), H33 (≠ N33), F34 (= F34), I35 (≠ F35), K43 (≠ S38), D62 (= D57), I63 (≠ V58), L81 (= L72), A82 (= A73), A83 (≠ C74), I124 (≠ A113), T126 (= T115), K153 (= K148), Y176 (≠ I171), T178 (≠ N173), V179 (≠ T174), R185 (≠ L180), M188 (≠ R185)
- binding uridine-5'-diphosphate: T178 (≠ N173), A189 (≠ V186), R192 (≠ N189), T204 (= T201), F206 (≠ Y203), Q211 (= Q208), R213 (= R210), I250 (≠ V246), E276 (≠ D272)
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
33% identity, 99% coverage: 3:309/309 of query aligns to 2:313/321 of 6zllA
- active site: T126 (= T115), S127 (= S116), S128 (≠ E117), Y149 (= Y144), K153 (= K148)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (= I13), D32 (= D32), H33 (≠ N33), F34 (= F34), I35 (≠ F35), K43 (≠ S38), D62 (= D57), I63 (≠ V58), L81 (= L72), A82 (= A73), A83 (≠ C74), I124 (≠ A113), T126 (= T115), Y149 (= Y144), K153 (= K148), Y176 (≠ I171), V179 (≠ T174), R185 (≠ L180), M188 (≠ R185)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (= P75), V87 (≠ S77), R88 (≠ P78), T126 (= T115), S127 (= S116), Y149 (= Y144), T178 (≠ N173), R185 (≠ L180), A189 (≠ V186), R192 (≠ N189), T204 (= T201), F206 (≠ Y203), Q211 (= Q208), R213 (= R210), I250 (≠ V246), E276 (≠ D272)
6zljA Crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and NAD (see paper)
32% identity, 99% coverage: 3:309/309 of query aligns to 2:313/314 of 6zljA
- active site: T126 (= T115), S127 (= S116), S128 (≠ E117), F149 (≠ W132), K153 (≠ N136)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (= I13), D32 (= D32), H33 (≠ N33), F34 (= F34), I35 (≠ F35), K43 (≠ S38), D62 (= D57), I63 (≠ V58), L81 (= L72), A82 (= A73), A83 (≠ C74), I124 (≠ A113), T126 (= T115), K153 (≠ N136), Y176 (≠ I171), T178 (≠ N173), V179 (≠ T174), R185 (≠ L180), M188 (≠ R185)
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: P85 (= P75), R88 (≠ P78), T126 (= T115), S127 (= S116), S128 (≠ E117), F149 (≠ W132), F177 (= F172), T178 (≠ N173), R185 (≠ L180), M188 (≠ R185), A189 (≠ V186), R192 (≠ N189), T204 (= T201), F206 (≠ Y203), Q211 (= Q208), R213 (= R210), I250 (≠ V246), E276 (≠ D272)
4m55E Crystal structure of human udp-xylose synthase r236h substitution (see paper)
33% identity, 76% coverage: 3:238/309 of query aligns to 1:156/164 of 4m55E
- active site: T105 (= T115)
- binding nicotinamide-adenine-dinucleotide: G6 (= G8), G9 (= G11), F10 (= F12), V11 (≠ I13), D30 (= D32), N31 (= N33), F32 (= F34), T34 (= T36), G35 (= G37), D55 (= D57), V56 (= V58), S72 (≠ C74), P73 (= P75), T81 (= T91), T105 (= T115), T131 (= T174)
8vr2B Crystal structure of the pcryo_0617 oxidoreductase/decarboxylase from psychrobacter cryohalolentis k5 in the presence of NAD and udp
30% identity, 99% coverage: 2:307/309 of query aligns to 8:312/321 of 8vr2B
- binding nicotinamide-adenine-dinucleotide: G14 (= G8), G17 (= G11), F18 (= F12), I19 (= I13), D37 (= D32), N38 (= N33), E40 (≠ S38), R41 (≠ K39), N61 (≠ D57), V62 (= V58), A81 (= A73), A82 (≠ C74), A83 (≠ P75), F124 (≠ A113), K154 (= K148), P177 (≠ I171), N179 (= N173)
- binding uridine-5'-diphosphate: R147 (= R141), G189 (≠ D183), A190 (≠ G184), M194 (≠ F190), Y205 (≠ T201), I206 (= I202), F207 (≠ Y203), R214 (= R210), I251 (≠ L247)
7ystA Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chain b from mycobacterium tuberculosis
31% identity, 99% coverage: 3:308/309 of query aligns to 2:310/312 of 7ystA
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (= I13), D31 (= D32), N32 (= N33), T35 (= T36), G36 (= G37), D56 (= D57), I57 (vs. gap), L77 (= L72), A78 (= A73), A79 (≠ C74), I81 (≠ A76), V96 (≠ T91), T119 (≠ Q112), Y146 (= Y144), K150 (= K148), P173 (≠ I171), A174 (≠ F172), N175 (= N173), V176 (≠ T174)
- binding uridine-5'-diphosphate-glucose: I81 (≠ A76), R84 (≠ I79), S121 (= S114), G123 (≠ S116), Y146 (= Y144), A174 (≠ F172), N175 (= N173), A187 (≠ G184), G188 (≠ R185), V189 (= V186), F193 (= F190), R204 (≠ T201), V205 (≠ I202), F206 (≠ Y203), R213 (= R210), D248 (≠ V246), R271 (≠ P269)
7ysmA Crystal structure of udp-glucose 4-epimerase (rv3634c) co-crystallized with udp-n-acetylglucosamine from mycobacterium tuberculosis
31% identity, 99% coverage: 3:308/309 of query aligns to 2:310/311 of 7ysmA
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (= I13), D31 (= D32), N32 (= N33), T35 (= T36), G36 (= G37), D56 (= D57), I57 (vs. gap), L77 (= L72), A78 (= A73), A79 (≠ C74), I81 (≠ A76), T119 (≠ Q112), Y146 (= Y144), K150 (= K148), P173 (≠ I171), N175 (= N173), V176 (≠ T174)
- binding uridine-diphosphate-n-acetylgalactosamine: I81 (≠ A76), R84 (≠ I79), S121 (= S114), G123 (≠ S116), S124 (≠ E117), Y146 (= Y144), A174 (≠ F172), N175 (= N173), G188 (≠ R185), V189 (= V186), F193 (= F190), R204 (≠ T201), V205 (≠ I202), F206 (≠ Y203), N211 (≠ Q208), R213 (= R210), D248 (≠ V246), R271 (≠ P269)
7ys9A Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis
31% identity, 99% coverage: 3:308/309 of query aligns to 2:310/310 of 7ys9A
- binding galactose-uridine-5'-diphosphate: I81 (≠ A76), R84 (≠ I79), S121 (= S114), G123 (≠ S116), Y146 (= Y144), A174 (≠ F172), N175 (= N173), A187 (≠ G184), G188 (≠ R185), V189 (= V186), F193 (= F190), R204 (≠ T201), F206 (≠ Y203), N211 (≠ Q208), R213 (= R210), D248 (≠ V246), R271 (≠ P269)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (= I13), D31 (= D32), N32 (= N33), A34 (≠ F35), T35 (= T36), G36 (= G37), D56 (= D57), I57 (vs. gap), L77 (= L72), A78 (= A73), A79 (≠ C74), I81 (≠ A76), T119 (≠ Q112), Y146 (= Y144), K150 (= K148), P173 (≠ I171), A174 (≠ F172), V176 (≠ T174)
- binding uridine-5'-diphosphate-glucose: I81 (≠ A76), R84 (≠ I79), S121 (= S114), G123 (≠ S116), Y146 (= Y144), A174 (≠ F172), N175 (= N173), A187 (≠ G184), G188 (≠ R185), V189 (= V186), F193 (= F190), R204 (≠ T201), F206 (≠ Y203), N211 (≠ Q208), R213 (= R210), D248 (≠ V246), R271 (≠ P269)
6bwlA X-ray structure of pal from bacillus thuringiensis (see paper)
30% identity, 99% coverage: 3:309/309 of query aligns to 2:312/313 of 6bwlA
- active site: T122 (= T115), C123 (≠ S116), M124 (≠ E117), Y147 (= Y144), K151 (= K148)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (= I13), D31 (= D32), N32 (= N33), L33 (≠ F34), N35 (≠ T36), S36 (≠ G37), D57 (= D57), I58 (≠ V58), L79 (= L72), A80 (= A73), A81 (≠ C74), I83 (≠ A76), M120 (≠ A113), K151 (= K148), N176 (= N173), T177 (= T174)
- binding uridine-5'-diphosphate: N176 (= N173), G189 (≠ R185), V190 (= V186), N205 (≠ T201), I206 (= I202), Y207 (= Y203), Q212 (= Q208), R214 (= R210), I250 (≠ V246), E275 (≠ D272)
6h0pA The structure of c100a mutant of arabidopsis thaliana udp-apiose/udp- xylose synthase in complex with nadh and udp-d-glucuronic acid (see paper)
29% identity, 98% coverage: 4:305/309 of query aligns to 13:363/375 of 6h0pA
- binding nicotinamide-adenine-dinucleotide: G17 (= G8), G20 (= G11), F21 (= F12), I22 (= I13), D42 (= D32), N69 (vs. gap), I70 (vs. gap), L89 (= L72), A90 (= A73), A91 (≠ C74), A93 (= A76), F130 (≠ A113), Y178 (= Y144), K182 (= K148)
- binding uridine-5'-diphosphate-glucuronic acid: P95 (= P78), Y98 (= Y81), T132 (= T115), E134 (= E117), R175 (= R141), Y178 (= Y144), N207 (= N173), R228 (= R185), V229 (= V186), C232 (≠ N189), F233 (= F190), V246 (≠ Y203), R253 (= R210), V291 (= V246), F323 (vs. gap), Y324 (vs. gap), Y328 (vs. gap), D330 (= D272), R334 (= R276)
6h0nA The structure of wild-type arabidopsis thaliana udp-apiose/udp-xylose synthase in complex with NAD+ and udp (see paper)
29% identity, 98% coverage: 4:305/309 of query aligns to 13:363/377 of 6h0nA
- binding nicotinamide-adenine-dinucleotide: G17 (= G8), G20 (= G11), F21 (= F12), I22 (= I13), D42 (= D32), V43 (≠ N33), I68 (≠ V54), N69 (vs. gap), I70 (vs. gap), L89 (= L72), A90 (= A73), A91 (≠ C74), C93 (≠ A76), S131 (= S114), T132 (= T115), Y178 (= Y144), K182 (= K148), P205 (≠ I171), N207 (= N173), W208 (≠ T174), R228 (= R185)
- binding uridine-5'-diphosphate: P95 (= P78), R175 (= R141), R228 (= R185), V229 (= V186), C232 (≠ N189), V246 (≠ Y203), R253 (= R210), V291 (= V246), F323 (vs. gap), Y324 (vs. gap), Y328 (vs. gap), D330 (= D272), R334 (= R276)
3aw9A Structure of udp-galactose 4-epimerase mutant
29% identity, 98% coverage: 3:304/309 of query aligns to 2:298/304 of 3aw9A
- active site: A105 (= A113), S107 (≠ T115), S108 (= S116), T109 (≠ E117), Y131 (= Y144), K135 (= K148), L166 (≠ M179), G169 (≠ N182)
- binding galactose-uridine-5'-diphosphate: P69 (= P78), V71 (≠ H80), S107 (≠ T115), Y131 (= Y144), N160 (= N173), H168 (≠ P181), V170 (= V186), D173 (≠ N189), L188 (≠ Y203), Q193 (= Q208), K195 (≠ R210), Y197 (≠ F212), V234 (= V246), W263 (≠ R276), D266 (= D279)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (= I13), D31 (= D40), I32 (≠ N41), R46 (= R55), D47 (≠ H56), L48 (≠ D57), F65 (≠ L72), A66 (= A73), A67 (= A76), E82 (≠ T91), A105 (= A113), S106 (= S114), Y131 (= Y144), K135 (= K148), Y158 (≠ I171), N160 (= N173), V161 (≠ T174), H168 (≠ P181)
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
27% identity, 97% coverage: 2:302/309 of query aligns to 2:304/308 of 6wj9B
- active site: A119 (≠ T115), A120 (≠ S116), A121 (≠ E117), F144 (≠ V138), K148 (≠ R149)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (= F12), I13 (= I13), D32 (= D32), D33 (≠ N33), S35 (≠ F35), T36 (= T36), G37 (= G37), D55 (= D57), A56 (≠ V58), L75 (= L72), A76 (= A73), A77 (≠ C74), S94 (≠ T91), A117 (= A113), A119 (≠ T115), F144 (≠ V138), K148 (≠ R149), F171 (≠ I171), F172 (= F172), I174 (≠ T174)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (≠ P78), N173 (= N173), G187 (≠ R185), V188 (= V186), F192 (= F190), T203 (= T201), L204 (≠ I202), F205 (≠ Y203), R212 (= R210), L248 (≠ V246), R271 (≠ P269), D274 (= D272)
Query Sequence
>350587 FitnessBrowser__Btheta:350587
MKRILVSGGAGFIGSHLCTRLVNEGHDVICLDNFFTGSKDNIKHLMGNHHFEVVRHDVTY
PYSAEVDEIYNLACPASPIHYQHDPIQTAKTSVMGAINMLGLAMRLDAKILQASTSEVYG
DPIIHPQPESYWGNVNPVGYRSCYDEGKRCAETLFMDYYRQNQTRIKIIRIFNTYGPRML
PNDGRVVSNFIIQALNNEDITIYGDGKQTRSFQYIDDLIEGMVRMMDTEDDFTGPINIGN
PNEFPVLELAERVIRMTGSTSKIVFKPLPTDDPKQRQPDIKLAKEKLGWQPTVELEDGLK
RMIEYFKNV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory