SitesBLAST
Comparing 350630 FitnessBrowser__Btheta:350630 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4pfkA Phosphofructokinase. Structure and control (see paper)
49% identity, 99% coverage: 4:327/327 of query aligns to 2:319/319 of 4pfkA
- active site: G11 (= G13), R72 (= R74), C73 (≠ S75), D103 (= D105), G104 (= G106), G124 (= G127), T125 (= T128), D127 (= D130), D129 (= D132), R171 (= R174)
- binding adenosine-5'-diphosphate: S9 (= S11), Y41 (= Y43), R72 (= R74), C73 (≠ S75), F76 (= F78), K77 (≠ T79), G104 (= G106), G108 (= G110), R154 (= R157), G185 (= G188), R211 (≠ K214), G212 (≠ T215), K213 (= K216), H215 (≠ S218)
- binding 6-O-phosphono-beta-D-fructofuranose: D127 (= D130), M169 (= M172), E222 (= E225), H249 (= H257), R252 (= R260)
- binding magnesium ion: G185 (= G188), E187 (= E190)
3pfkA Phosphofructokinase. Structure and control (see paper)
49% identity, 99% coverage: 4:327/327 of query aligns to 2:319/319 of 3pfkA
- active site: G11 (= G13), R72 (= R74), C73 (≠ S75), D103 (= D105), G104 (= G106), G124 (= G127), T125 (= T128), D127 (= D130), D129 (= D132), R171 (= R174)
- binding phosphate ion: R154 (= R157), K213 (= K216), H249 (= H257), R252 (= R260)
6pfkA Phosphofructokinase, inhibited t-state (see paper)
49% identity, 99% coverage: 4:327/327 of query aligns to 2:319/319 of 6pfkA
- active site: G11 (= G13), R72 (= R74), C73 (≠ S75), D103 (= D105), G104 (= G106), G124 (= G127), T125 (= T128), D127 (= D130), D129 (= D132), R171 (= R174)
- binding 2-phosphoglycolic acid: R21 (= R23), R25 (= R27), G58 (≠ S60), D59 (≠ S61), R154 (= R157), R211 (≠ K214), K213 (= K216)
P00512 ATP-dependent 6-phosphofructokinase; ATP-PFK; Phosphofructokinase; Phosphohexokinase; EC 2.7.1.11 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
49% identity, 99% coverage: 4:327/327 of query aligns to 2:319/319 of P00512
- RSVVR 21:25 (≠ RAVTR 23:27) binding
- D59 (≠ S61) binding
- RC 72:73 (≠ RS 74:75) binding
- D103 (= D105) binding
- TID 125:127 (= TID 128:130) binding in other chain
- R154 (= R157) binding in other chain
- R162 (= R165) binding
- MGR 169:171 (= MGR 172:174) binding in other chain
- GAE 185:187 (= GAE 188:190) binding in other chain
- R211 (≠ K214) binding in other chain
- KKH 213:215 (≠ KNS 216:218) binding in other chain
- E222 (= E225) binding in other chain
- R243 (= R251) binding
- HVQR 249:252 (≠ HLQR 257:260) binding in other chain
1mtoA Crystal structure of a phosphofructokinase mutant from bacillus stearothermophilus bound with fructose-6-phosphate (see paper)
49% identity, 99% coverage: 4:327/327 of query aligns to 2:319/319 of 1mtoA
- active site: G11 (= G13), R72 (= R74), C73 (≠ S75), D103 (= D105), G104 (= G106), G124 (= G127), T125 (= T128), D127 (= D130), D129 (= D132), R171 (= R174)
- binding 6-O-phosphono-beta-D-fructofuranose: D127 (= D130), R162 (= R165), M169 (= M172), R171 (= R174), E222 (= E225), R243 (= R251), H249 (= H257), R252 (= R260)
4i4iA Crystal structure of bacillus stearothermophilus phosphofructokinase mutant t156a bound to pep (see paper)
49% identity, 99% coverage: 4:327/327 of query aligns to 2:319/319 of 4i4iA
- active site: G11 (= G13), R72 (= R74), C73 (≠ S75), D103 (= D105), G104 (= G106), G124 (= G127), T125 (= T128), D127 (= D130), D129 (= D132), R171 (= R174)
- binding phosphoenolpyruvate: R21 (= R23), R25 (= R27), G58 (≠ S60), R154 (= R157), R211 (≠ K214), K213 (= K216), H215 (≠ S218)
5xzaA Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adp (see paper)
48% identity, 99% coverage: 4:327/327 of query aligns to 2:322/322 of 5xzaA
Q2FXM8 ATP-dependent 6-phosphofructokinase; ATP-PFK; Phosphofructokinase; Phosphohexokinase; EC 2.7.1.11 from Staphylococcus aureus (strain NCTC 8325 / PS 47) (see paper)
48% identity, 99% coverage: 4:327/327 of query aligns to 2:322/322 of Q2FXM8
- RC 72:73 (≠ RS 74:75) binding
- GDGS 102:105 (= GDGS 104:107) binding
- TID 127:129 (= TID 128:130) binding in other chain
- G150 (≠ E151) mutation to D: Exhibits higher affinity for fructose 6-phosphate and higher catalytic activity with a loss of dimer conversion; in association with A-151.
- L151 (≠ C152) mutation to A: Exhibits higher affinity for fructose 6-phosphate and higher catalytic activity with a loss of tetramer-dimer conversion; in association with D-150.
- R164 (= R165) mutation to A: Complete loss of fructose 6-phosphate binding.
- MGR 171:173 (= MGR 172:174) binding in other chain
- E224 (= E225) binding in other chain
- R245 (= R251) mutation to A: Complete loss of fructose 6-phosphate binding.
- HVQR 251:254 (≠ HLQR 257:260) binding in other chain
5xz9A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
48% identity, 99% coverage: 4:326/327 of query aligns to 2:321/321 of 5xz9A
- binding adenosine-5'-triphosphate: S9 (= S11), Y41 (= Y43), C73 (≠ S75), F76 (= F78), K77 (≠ T79), G102 (= G104), D103 (= D105), G104 (= G106), S105 (= S107), R107 (≠ T109), G108 (= G110)
5xz7A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
48% identity, 99% coverage: 4:327/327 of query aligns to 2:318/322 of 5xz7A
5xz6A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
48% identity, 99% coverage: 4:327/327 of query aligns to 2:318/318 of 5xz6A
P17858 ATP-dependent 6-phosphofructokinase, liver type; ATP-PFK; PFK-L; 6-phosphofructokinase type B; Phosphofructo-1-kinase isozyme B; PFK-B; Phosphohexokinase; EC 2.7.1.11 from Homo sapiens (Human) (see 3 papers)
43% identity, 96% coverage: 4:318/327 of query aligns to 16:362/780 of P17858
- G81 (= G67) natural variant: G -> A
- R151 (vs. gap) to W: in dbSNP:rs755851304
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 527 T→A: Does not affect GlcNAcylation.
- 529 modified: carbohydrate, O-linked (GlcNAc) serine; S→A: Prevents GlcNAcylation and enhance enzyme activity.
7lw1A Human phosphofructokinase-1 liver type bound to activator na-11 (see paper)
43% identity, 96% coverage: 4:318/327 of query aligns to 6:352/744 of 7lw1A
- binding adenosine-5'-diphosphate: R78 (= R74), C79 (≠ S75), T83 (= T79), G108 (= G104), G110 (= G106), S111 (= S107), G114 (= G110), I117 (= I113)
- binding 6-O-phosphono-beta-D-fructofuranose: I155 (= I129), D156 (= D130), R191 (= R165), M198 (= M172), R200 (= R174), E254 (= E225), R282 (= R251), H288 (= H257), R291 (= R260)
- binding N-{(11S)-2-[2-(5-hydroxypent-1-yn-1-yl)phenyl]-4H,10H-pyrazolo[5,1-c][1,4]benzoxazepin-7-yl}acetamide: M164 (≠ F138), F298 (≠ N267), I301 (= I270), K305 (≠ R274), N331 (= N297)
Sites not aligning to the query:
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: 399, 460, 519, 555, 562, 618, 644, 650, 724
- binding N-{(11S)-2-[2-(5-hydroxypent-1-yn-1-yl)phenyl]-4H,10H-pyrazolo[5,1-c][1,4]benzoxazepin-7-yl}acetamide: 527, 532, 535, 568, 660, 730, 734
P08237 ATP-dependent 6-phosphofructokinase, muscle type; ATP-PFK; PFK-M; 6-phosphofructokinase type A; Phosphofructo-1-kinase isozyme A; PFK-A; Phosphohexokinase; EC 2.7.1.11 from Homo sapiens (Human) (see 6 papers)
42% identity, 96% coverage: 4:318/327 of query aligns to 16:362/780 of P08237
- R39 (= R27) to P: in GSD7; Italian; dbSNP:rs121918193
- G57 (= G45) to V: in GSD7; Italian
- R100 (≠ K86) to Q: in dbSNP:rs2228500
- S180 (≠ T144) to C: in GSD7; Italian
- G209 (= G173) to D: in GSD7; loss of activity shown by complementation assays in yeast; dbSNP:rs767265360
- D309 (= D268) to G: in GSD7; Spanish; complete loss of enzyme activity; dbSNP:rs1169383137
Sites not aligning to the query:
- 543 D → A: in GSD7; Italian; dbSNP:rs121918194
- 557 modified: N6-(2-hydroxyisobutyryl)lysine
- 591 D → A: in GSD7; Italian
- 686 W → C: in GSD7; Japanese; dbSNP:rs121918196
- 696 R → H: in dbSNP:rs41291971
P00511 ATP-dependent 6-phosphofructokinase, muscle type; ATP-PFK; PFK-M; 6-phosphofructokinase type A; Phosphofructo-1-kinase isozyme A; PFK-A; Phosphohexokinase; EC 2.7.1.11 from Oryctolagus cuniculus (Rabbit) (see 2 papers)
41% identity, 96% coverage: 4:318/327 of query aligns to 16:362/780 of P00511
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylthreonine
- 775 modified: Phosphoserine; by PKA
4xykA Crystal structure of human phosphofructokinase-1 in complex with adp, northeast structural genomics consortium target hr9275 (see paper)
41% identity, 96% coverage: 4:318/327 of query aligns to 9:355/737 of 4xykA
- active site: G18 (= G13), R81 (= R74), C82 (≠ S75), D112 (= D105), G156 (= G127), S157 (≠ T128), D159 (= D130), D161 (= D132), R203 (= R174)
- binding adenosine-5'-diphosphate: Y48 (= Y43), R81 (= R74), C82 (≠ S75), R86 (≠ T79), G111 (= G104), D112 (= D105), G113 (= G106), S114 (= S107)
- binding phosphate ion: R28 (= R23), R32 (= R27), S67 (= S60), K248 (= K216)
Sites not aligning to the query:
4xyjF Crystal structure of human phosphofructokinase-1 in complex with atp and mg, northeast structural genomics consortium target hr9275 (see paper)
41% identity, 96% coverage: 4:318/327 of query aligns to 11:357/761 of 4xyjF
- active site: G20 (= G13), R83 (= R74), C84 (≠ S75), D114 (= D105), G158 (= G127), S159 (≠ T128), D161 (= D130), D163 (= D132), R205 (= R174)
- binding adenosine-5'-triphosphate: G20 (= G13), Y50 (= Y43), R83 (= R74), C84 (≠ S75), F87 (= F78), R88 (≠ T79), G113 (= G104), D114 (= D105), G115 (= G106), S116 (= S107), G119 (= G110), S159 (≠ T128)
- binding magnesium ion: G19 (= G12), G20 (= G13), G112 (= G103), D114 (= D105), G158 (= G127), D163 (= D132), R205 (= R174)
- binding phosphate ion: R30 (= R23), R34 (= R27), S69 (= S60), S70 (= S61), G219 (= G188), K250 (= K216)
Sites not aligning to the query:
1pfkA Crystal structure of the complex of phosphofructokinase from escherichia coli with its reaction products (see paper)
46% identity, 94% coverage: 4:312/327 of query aligns to 3:305/320 of 1pfkA
- active site: G12 (= G13), R73 (= R74), F74 (≠ S75), D104 (= D105), G105 (= G106), G125 (= G127), T126 (= T128), D128 (= D130), D130 (= D132), R172 (= R174)
- binding adenosine-5'-diphosphate: G11 (= G12), R22 (= R23), R26 (= R27), Y56 (≠ E57), S59 (= S60), D60 (≠ S61), R73 (= R74), F74 (≠ S75), F77 (= F78), R78 (≠ T79), G103 (= G104), D104 (= D105), G105 (= G106), S106 (= S107), M108 (≠ T109), G109 (= G110), R155 (= R157), G213 (≠ T215), K214 (= K216), H216 (≠ S218)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: G12 (= G13), R73 (= R74), T126 (= T128), D128 (= D130), M170 (= M172), E223 (= E225), H250 (= H257), R253 (= R260)
- binding magnesium ion: G186 (= G188), E188 (= E190)
P0A796 ATP-dependent 6-phosphofructokinase isozyme 1; ATP-PFK 1; Phosphofructokinase 1; 6-phosphofructokinase isozyme I; Phosphohexokinase 1; Sedoheptulose-7-phosphate kinase; EC 2.7.1.11 from Escherichia coli (strain K12) (see 2 papers)
46% identity, 94% coverage: 4:312/327 of query aligns to 3:305/320 of P0A796
- G12 (= G13) binding
- RGVVR 22:26 (≠ RAVTR 23:27) binding
- RYSVSD 55:60 (≠ TEDVSS 56:61) binding
- RF 73:74 (≠ RS 74:75) binding
- GDGS 103:106 (= GDGS 104:107) binding
- D104 (= D105) binding
- TID 126:128 (= TID 128:130) binding in other chain
- D128 (= D130) active site, Proton acceptor; mutation to S: 18000-fold reduction of catalytic rate.
- R155 (= R157) binding in other chain
- R163 (= R165) binding
- R172 (= R174) mutation to S: 3.4-fold reduction in turnover numbers.
- GCE 186:188 (≠ GAE 188:190) binding in other chain
- KKH 214:216 (≠ KNS 216:218) binding in other chain
- E223 (= E225) binding in other chain
- R244 (= R251) binding
- HIQR 250:253 (≠ HLQR 257:260) binding in other chain
4xyjA Crystal structure of human phosphofructokinase-1 in complex with atp and mg, northeast structural genomics consortium target hr9275 (see paper)
41% identity, 96% coverage: 4:318/327 of query aligns to 13:359/768 of 4xyjA
- active site: G22 (= G13), R85 (= R74), C86 (≠ S75), D116 (= D105), G160 (= G127), S161 (≠ T128), D163 (= D130), D165 (= D132), R207 (= R174)
- binding adenosine-5'-triphosphate: G21 (= G12), G22 (= G13), Y52 (= Y43), C86 (≠ S75), F89 (= F78), R90 (≠ T79), G115 (= G104), D116 (= D105), G117 (= G106), S118 (= S107), G121 (= G110), S161 (≠ T128), R207 (= R174)
- binding magnesium ion: G21 (= G12), G22 (= G13), D116 (= D105), D165 (= D132)
- binding phosphate ion: R32 (= R23), R36 (= R27), S72 (= S61), G221 (= G188), K252 (= K216)
Sites not aligning to the query:
Query Sequence
>350630 FitnessBrowser__Btheta:350630
MDNKYIGILTSGGDASGMNAAIRAVTRAAIFNGFKVKGIYRGYEGLIAGEVKELTTEDVS
SIIQRGGTILKTARSETFTTPEGRKKAYKVIQKENINALIIIGGDGSLTGARIFAEEYDV
TCIGLPGTIDNDLYGTDFTIGYDTALNTIVECVDKIRDTATSHDRIFFVEVMGRDAGFLA
QNSAIASGAEAAIIPEDRTDVDQLETFIGRGFRKTKNSSIVIVTESPENKNGGAIYYADR
VKKEYPGYDVRVSILGHLQRGGAPSANDRILASRLGEAAIQALMEGQRNVMIGIRNNEIV
YVPFVQAIKKDKPIDKSLIRVLNELSI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory