Comparing 350674 FitnessBrowser__Btheta:350674 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xf4A Crystal structure of salmonella enterica serovar typhimurium ycbl (see paper)
36% identity, 100% coverage: 2:203/203 of query aligns to 11:209/210 of 2xf4A
7ev5A Crystal structure of bleg-1 b3 metallo-beta-lactamase (see paper)
38% identity, 98% coverage: 4:202/203 of query aligns to 12:207/209 of 7ev5A
2zwrB Crystal structure of ttha1623 from thermus thermophilus hb8 (see paper)
35% identity, 98% coverage: 5:202/203 of query aligns to 14:200/207 of 2zwrB
2zziA Crystal structure of ttha1623 in a di-iron-bound form (see paper)
35% identity, 98% coverage: 5:202/203 of query aligns to 12:198/198 of 2zziA
7l0bA Crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme (see paper)
32% identity, 100% coverage: 1:202/203 of query aligns to 11:200/202 of 7l0bA
6sg9FL uS3m (see paper)
28% identity, 98% coverage: 2:199/203 of query aligns to 62:294/320 of 6sg9FL
Sites not aligning to the query:
O95571 Persulfide dioxygenase ETHE1, mitochondrial; Ethylmalonic encephalopathy protein 1; Hepatoma subtracted clone one protein; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Homo sapiens (Human) (see 4 papers)
31% identity, 98% coverage: 3:200/203 of query aligns to 31:213/254 of O95571
Sites not aligning to the query:
4chlB Human ethylmalonic encephalopathy protein 1 (hethe1) (see paper)
31% identity, 98% coverage: 3:200/203 of query aligns to 15:197/237 of 4chlB
4ysbA Crystal structure of ethe1 from myxococcus xanthus (see paper)
28% identity, 96% coverage: 6:200/203 of query aligns to 15:188/225 of 4ysbA
Q9C8L4 Persulfide dioxygenase ETHE1 homolog, mitochondrial; Glyoxalase II; Glx II; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 96% coverage: 6:200/203 of query aligns to 66:250/294 of Q9C8L4
2gcuA X-ray structure of gene product from arabidopsis thaliana at1g53580 (see paper)
28% identity, 96% coverage: 6:200/203 of query aligns to 17:201/244 of 2gcuA
5ve5A Crystal structure of persulfide dioxygenase rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans in complex with glutathione (see paper)
29% identity, 96% coverage: 7:200/203 of query aligns to 19:194/350 of 5ve5A
Sites not aligning to the query:
3r2uB 2.1 angstrom resolution crystal structure of metallo-beta-lactamase from staphylococcus aureus subsp. Aureus col
28% identity, 89% coverage: 13:193/203 of query aligns to 27:196/336 of 3r2uB
Sites not aligning to the query:
3tp9A Crystal structure of alicyclobacillus acidocaldarius protein with beta-lactamase and rhodanese domains
27% identity, 90% coverage: 12:193/203 of query aligns to 24:205/473 of 3tp9A
Q9SID3 Hydroxyacylglutathione hydrolase 2, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
24% identity, 97% coverage: 7:203/203 of query aligns to 85:292/324 of Q9SID3
2q42A Ensemble refinement of the protein crystal structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 (see paper)
24% identity, 98% coverage: 6:203/203 of query aligns to 14:222/254 of 2q42A
Q68D91 Acyl-coenzyme A thioesterase MBLAC2; Acyl-CoA thioesterase MBLAC2; Beta-lactamase MBLAC2; Metallo-beta-lactamase domain-containing protein 2; Palmitoyl-coenzyme A thioesterase MBLAC2; EC 3.1.2.2; EC 3.5.2.6 from Homo sapiens (Human) (see 3 papers)
29% identity, 73% coverage: 49:196/203 of query aligns to 82:239/279 of Q68D91
Sites not aligning to the query:
4efzA Crystal structure of a hypothetical metallo-beta-lactamase from burkholderia pseudomallei
25% identity, 99% coverage: 3:203/203 of query aligns to 13:239/295 of 4efzA
3r2uA 2.1 angstrom resolution crystal structure of metallo-beta-lactamase from staphylococcus aureus subsp. Aureus col
27% identity, 94% coverage: 13:202/203 of query aligns to 25:225/348 of 3r2uA
4ad9A Crystal structure of human lactb2. (see paper)
28% identity, 78% coverage: 29:187/203 of query aligns to 60:200/288 of 4ad9A
>350674 FitnessBrowser__Btheta:350674
MFPVNCYVLWDDTKEAVVIDPGCFYEEEKQALKKFILTNELTVKHLLNTHLHLDHIFGNP
FMLKEFGLSAEANKADEFWIDEAPKQSRMFGFQLQEEPVPLGKYLHDGDIITFGHTKLEA
IHVPGHSPGSLVYYCKEENCMFSGDVLFQGSIGRADLSGGNFDELIDHICSRLFVLPNET
VVYPGHGAPTTIGMEKAENPFFR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory