SitesBLAST
Comparing 350680 FitnessBrowser__Btheta:350680 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4njoA Crystal structure of cofactor(NAD+) bound 3-phosphoglycerate dehydrogenase in entamoeba histolytica (see paper)
49% identity, 100% coverage: 1:306/306 of query aligns to 3:300/302 of 4njoA
- active site: N104 (= N102), R219 (= R224), D243 (= D248), S248 (≠ A253), K265 (= K271)
- binding nicotinamide-adenine-dinucleotide: A80 (= A78), V108 (= V106), G143 (= G141), Y144 (≠ N142), V145 (= V143), D164 (= D162), F166 (= F164), H189 (= H194), L190 (≠ I195), P191 (= P196), T217 (= T222), A218 (= A223), R219 (= R224), K265 (= K271), G267 (= G273)
4njmA Crystal structure of phosphoglycerate bound 3-phosphoglycerate dehydrogenase in entamoeba histolytica (see paper)
49% identity, 100% coverage: 1:306/306 of query aligns to 3:300/303 of 4njmA
- active site: N104 (= N102), R219 (= R224), D243 (= D248), S248 (≠ A253), K265 (= K271)
- binding 3-phosphoglyceric acid: K11 (= K9), R57 (= R55), S58 (= S56), R77 (= R75), G79 (= G77), A80 (= A78), N104 (= N102), R219 (= R224), K265 (= K271), A268 (= A274)
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
33% identity, 91% coverage: 20:296/306 of query aligns to 16:304/305 of 6plfA
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
33% identity, 91% coverage: 20:296/306 of query aligns to 15:303/303 of 6plgA
7dkmA Phgdh covalently linked to oridonin (see paper)
33% identity, 91% coverage: 20:296/306 of query aligns to 16:304/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ A78), A102 (≠ V106), G148 (≠ A139), R151 (≠ N142), I152 (≠ V143), Y170 (= Y161), D171 (= D162), P172 (≠ A163), I173 (≠ F164), H202 (= H194), T203 (≠ I195), P204 (= P196), T209 (= T201), C230 (≠ T222), A231 (= A223), R232 (= R224), H279 (≠ K271), G281 (= G273)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: K17 (= K21), I18 (≠ E22), E293 (≠ I285)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
33% identity, 91% coverage: 20:296/306 of query aligns to 20:308/533 of O43175
- T78 (≠ A78) binding
- R135 (vs. gap) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ NV 142:143) binding
- D175 (= D162) binding
- T207 (≠ I195) binding
- CAR 234:236 (≠ TAR 222:224) binding
- D260 (≠ K244) binding
- V261 (≠ Y245) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ KMGA 271:274) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
34% identity, 89% coverage: 20:292/306 of query aligns to 14:298/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (= N102), A100 (≠ V106), R149 (≠ N142), I150 (≠ V143), Y168 (= Y161), D169 (= D162), P170 (≠ A163), I171 (≠ F164), H200 (= H194), T201 (≠ I195), P202 (= P196), T207 (= T201), C228 (≠ T222), A229 (= A223), R230 (= R224), H277 (≠ K271), G279 (= G273)
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
34% identity, 89% coverage: 20:292/306 of query aligns to 12:296/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G141), I148 (≠ V143), Y166 (= Y161), D167 (= D162), P168 (≠ A163), I169 (≠ F164), I170 (≠ C165), H198 (= H194), T199 (≠ I195), L208 (≠ S204), R228 (= R224)
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
34% identity, 89% coverage: 20:292/306 of query aligns to 15:299/301 of 6rj5A
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
34% identity, 89% coverage: 20:292/306 of query aligns to 15:299/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ H138), G147 (≠ A139), L148 (≠ Y140), G149 (= G141), R150 (≠ N142), I151 (≠ V143), G152 (= G144), D170 (= D162), H201 (= H194), T202 (≠ I195), P203 (= P196)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
34% identity, 89% coverage: 20:292/306 of query aligns to 15:299/302 of 6rihA
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
33% identity, 87% coverage: 20:284/306 of query aligns to 14:290/297 of 6rj3A
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
34% identity, 84% coverage: 35:292/306 of query aligns to 23:290/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (≠ N142), Y160 (= Y161), D161 (= D162), P162 (≠ A163), I164 (≠ C165), L179 (≠ A181), T193 (≠ I195), P194 (= P196), S198 (≠ E200), L202 (≠ S204)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
35% identity, 97% coverage: 1:296/306 of query aligns to 1:303/304 of 1wwkA
- active site: S96 (≠ N102), R230 (= R224), D254 (= D248), E259 (vs. gap), H278 (≠ K271)
- binding nicotinamide-adenine-dinucleotide: V100 (= V106), G146 (≠ A139), F147 (≠ Y140), G148 (= G141), R149 (≠ N142), I150 (≠ V143), Y168 (= Y161), D169 (= D162), P170 (≠ A163), V201 (≠ I195), P202 (= P196), T207 (= T201), T228 (= T222), S229 (≠ A223), D254 (= D248), H278 (≠ K271), G280 (= G273)
2eklA Structure of st1218 protein from sulfolobus tokodaii
31% identity, 85% coverage: 39:297/306 of query aligns to 36:308/312 of 2eklA
- active site: S100 (≠ N102), R232 (= R224), D256 (= D248), E261 (vs. gap), H282 (≠ K271)
- binding nicotinamide-adenine-dinucleotide: I76 (≠ A78), S100 (≠ N102), G148 (≠ A139), G150 (= G141), R151 (≠ N142), I152 (≠ V143), Y170 (= Y161), D171 (= D162), I172 (≠ A163), L173 (≠ F164), H202 (= H194), V203 (≠ I195), T204 (≠ P196), I212 (≠ S204), T230 (= T222), S231 (≠ A223), D256 (= D248), G284 (= G273)
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
35% identity, 83% coverage: 38:291/306 of query aligns to 31:297/526 of 3dc2A
Sites not aligning to the query:
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
35% identity, 83% coverage: 38:291/306 of query aligns to 32:298/525 of 3ddnB
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
34% identity, 66% coverage: 39:239/306 of query aligns to 36:256/334 of 5aovA
- active site: L100 (≠ N102), R241 (= R224)
- binding glyoxylic acid: M52 (≠ I54), L53 (≠ R55), L53 (≠ R55), Y74 (≠ A76), A75 (≠ G77), V76 (≠ A78), G77 (= G79), R241 (= R224)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ A78), T104 (≠ V106), F158 (≠ Y140), G159 (= G141), R160 (≠ N142), I161 (≠ V143), S180 (≠ D162), R181 (≠ A163), A211 (≠ H194), V212 (≠ I195), P213 (= P196), T218 (= T201), I239 (≠ T222), A240 (= A223), R241 (= R224)
Sites not aligning to the query:
5z20F The ternary structure of d-lactate dehydrogenase from pseudomonas aeruginosa with nadh and oxamate (see paper)
33% identity, 69% coverage: 27:238/306 of query aligns to 31:255/336 of 5z20F
- active site: S108 (≠ N102), R241 (= R224)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y107 (≠ Q101), G160 (= G141), Q161 (≠ N142), I162 (≠ V143), Y180 (= Y161), D181 (= D162), P182 (≠ A163), C212 (≠ I195), P213 (= P196), T218 (= T201), T239 (= T222), G240 (≠ A223), R241 (= R224)
Sites not aligning to the query:
P87228 Putative D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 89% coverage: 27:298/306 of query aligns to 76:371/466 of P87228
- S87 (≠ D38) modified: Phosphoserine
- S258 (≠ T198) modified: Phosphoserine
Query Sequence
>350680 FitnessBrowser__Btheta:350680
MKVLVATEKPFAKVAVDGIRKEIEAAGYELALLEKYTDKAQLLDAVKDANAIIIRSDIID
AEVLDAAKELKIVVRAGAGYDNVDLAAATAHNVCVMNTPGQNSNAVAELALGMMVYAVRN
FYNGTSGTELMGKKLGIHAYGNVGRNVARVAKGFGMEVYAYDAFCPKEVIEKDGVKALDS
AEELYKTCQVVSLHIPATAETKNSINYALLKDMPKGAMLVNTARKEVINEAELIKLMEDR
ADFKYMTDIMPAANAEFAEKFAGRYFSTPKKMGAQTAEANINAGIAAAQQIVGFLKDGCE
KFRVNK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory